Bhi10G001241 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAAAAAAAAAATGAAGACTGTAATAGAATTGTTAGAGAAACATTACATTGAGGCTGGTCGTTTAGGACTAGTCGCCAATGAATCTGCACGACCAGACATTGATATCATTGACCAATTTCGAGAGACAATTTCAGAGCTCGATGATTATGAAATTATGGGGAGGGATGTGGAAGTTGAAAGTATAGTTAAACAAGTGGTTGATGCTAGCCATCAAAAAGTTACATGTATCTTGCCCATTGTTGGTATTGGTGGATTGGGAAAAACAACTGTGGCCAAGTTAATTGATTGA ATGGCAAAAAAAAAAATGAAGACTGTAATAGAATTGTTAGAGAAACATTACATTGAGGCTGGTCGTTTAGGACTAGTCGCCAATGAATCTGCACGACCAGACATTGATATCATTGACCAATTTCGAGAGACAATTTCAGAGCTCGATGATTATGAAATTATGGGGAGGGATGTGGAAGTTGAAAGTATAGTTAAACAAGTGGTTGATGCTAGCCATCAAAAAGTTACATGTATCTTGCCCATTGTTGGTATTGGTGGATTGGGAAAAACAACTGTGGCCAAGTTAATTGATTGA ATGGCAAAAAAAAAAATGAAGACTGTAATAGAATTGTTAGAGAAACATTACATTGAGGCTGGTCGTTTAGGACTAGTCGCCAATGAATCTGCACGACCAGACATTGATATCATTGACCAATTTCGAGAGACAATTTCAGAGCTCGATGATTATGAAATTATGGGGAGGGATGTGGAAGTTGAAAGTATAGTTAAACAAGTGGTTGATGCTAGCCATCAAAAAGTTACATGTATCTTGCCCATTGTTGGTATTGGTGGATTGGGAAAAACAACTGTGGCCAAGTTAATTGATTGA MAKKKMKTVIELLEKHYIEAGRLGLVANESARPDIDIIDQFRETISELDDYEIMGRDVEVESIVKQVVDASHQKVTCILPIVGIGGLGKTTVAKLID
BLAST of Bhi10G001241 vs. TAIR10
Match: AT1G58807.1 (Disease resistance protein (CC-NBS-LRR class) family) HSP 1 Score: 40.0 bits (92), Expect = 9.5e-04 Identity = 23/65 (35.38%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of Bhi10G001241 vs. TAIR10
Match: AT1G59124.1 (Disease resistance protein (CC-NBS-LRR class) family) HSP 1 Score: 40.0 bits (92), Expect = 9.5e-04 Identity = 23/65 (35.38%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of Bhi10G001241 vs. Swiss-Prot
Match: sp|Q7XBQ9|RGA2_SOLBU (Disease resistance protein RGA2 OS=Solanum bulbocastanum OX=147425 GN=RGA2 PE=1 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.1e-04 Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 0
BLAST of Bhi10G001241 vs. Swiss-Prot
Match: sp|Q7XA42|RGA1_SOLBU (Putative disease resistance protein RGA1 OS=Solanum bulbocastanum OX=147425 GN=RGA1 PE=2 SV=2) HSP 1 Score: 47.0 bits (110), Expect = 1.4e-04 Identity = 25/56 (44.64%), Postives = 41/56 (73.21%), Query Frame = 0
BLAST of Bhi10G001241 vs. TrEMBL
Match: tr|A0A1S4E3X3|A0A1S4E3X3_CUCME (disease resistance protein RGA2-like OS=Cucumis melo OX=3656 GN=LOC103501129 PE=3 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 9.3e-30 Identity = 68/93 (73.12%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Bhi10G001241 vs. TrEMBL
Match: tr|Q6E436|Q6E436_CUCME (FOM-2 OS=Cucumis melo OX=3656 GN=Fom-2 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.7e-29 Identity = 67/93 (72.04%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of Bhi10G001241 vs. TrEMBL
Match: tr|A0A1S3CHQ5|A0A1S3CHQ5_CUCME (disease resistance protein RGA2-like OS=Cucumis melo OX=3656 GN=LOC103501070 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.7e-29 Identity = 67/92 (72.83%), Postives = 84/92 (91.30%), Query Frame = 0
BLAST of Bhi10G001241 vs. TrEMBL
Match: tr|A0A1S3C9H9|A0A1S3C9H9_CUCME (putative disease resistance protein RGA3 OS=Cucumis melo OX=3656 GN=LOC103498352 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.7e-29 Identity = 67/93 (72.04%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of Bhi10G001241 vs. TrEMBL
Match: tr|Q2V727|Q2V727_CUCME (R-FOM-2 OS=Cucumis melo OX=3656 PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.0e-28 Identity = 66/93 (70.97%), Postives = 83/93 (89.25%), Query Frame = 0
BLAST of Bhi10G001241 vs. NCBI nr
Match: XP_016902928.1 (PREDICTED: disease resistance protein RGA2-like [Cucumis melo]) HSP 1 Score: 138.3 bits (347), Expect = 1.4e-29 Identity = 68/93 (73.12%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Bhi10G001241 vs. NCBI nr
Match: AAS80152.1 (FOM-2 [Cucumis melo]) HSP 1 Score: 136.7 bits (343), Expect = 4.1e-29 Identity = 67/93 (72.04%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of Bhi10G001241 vs. NCBI nr
Match: XP_008459150.1 (PREDICTED: putative disease resistance protein RGA3 [Cucumis melo]) HSP 1 Score: 136.7 bits (343), Expect = 4.1e-29 Identity = 67/93 (72.04%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of Bhi10G001241 vs. NCBI nr
Match: XP_008462780.1 (PREDICTED: disease resistance protein RGA2-like [Cucumis melo]) HSP 1 Score: 136.7 bits (343), Expect = 4.1e-29 Identity = 67/92 (72.83%), Postives = 84/92 (91.30%), Query Frame = 0
BLAST of Bhi10G001241 vs. NCBI nr
Match: ABB91438.1 (R-FOM-2 [Cucumis melo]) HSP 1 Score: 134.8 bits (338), Expect = 1.6e-28 Identity = 66/93 (70.97%), Postives = 83/93 (89.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|