Bhi10G001164 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGGAGAAAATTCAGATCAGGAAGATCGATAATGCCACCGCGAGGCAGATCACTTTCTCCAAGCGTCGAATAGGACATTTCAAGAAAGCTAAAGAGCTTTCCATTTTATGCGATGCCGATGTTTCCATCGTTATCTTCTCCACCACTGGAAAGTTGTTTGAGTATTCCAGCTCAAGGTTTCTCTCTTTCTTAAATTTTATTTTTTCCAGAAACAAAAACTGTAATCAGTTTCCCACGTTTTCTGAGTTCTACGTTTCCTGA ATGGCGAAGGAGAAAATTCAGATCAGGAAGATCGATAATGCCACCGCGAGGCAGATCACTTTCTCCAAGCGTCGAATAGGACATTTCAAGAAAGCTAAAGAGCTTTCCATTTTATGCGATGCCGATGTTTCCATCGTTATCTTCTCCACCACTGGAAAGTTGTTTGAGTATTCCAGCTCAAGAAACAAAAACTGTAATCAGTTTCCCACGTTTTCTGAGTTCTACGTTTCCTGA ATGGCGAAGGAGAAAATTCAGATCAGGAAGATCGATAATGCCACCGCGAGGCAGATCACTTTCTCCAAGCGTCGAATAGGACATTTCAAGAAAGCTAAAGAGCTTTCCATTTTATGCGATGCCGATGTTTCCATCGTTATCTTCTCCACCACTGGAAAGTTGTTTGAGTATTCCAGCTCAAGAAACAAAAACTGTAATCAGTTTCCCACGTTTTCTGAGTTCTACGTTTCCTGA MAKEKIQIRKIDNATARQITFSKRRIGHFKKAKELSILCDADVSIVIFSTTGKLFEYSSSRNKNCNQFPTFSEFYVS
BLAST of Bhi10G001164 vs. TAIR10
Match: AT2G22540.1 (K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 99.8 bits (247), Expect = 8.0e-22 Identity = 49/63 (77.78%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of Bhi10G001164 vs. TAIR10
Match: AT4G24540.1 (AGAMOUS-like 24) HSP 1 Score: 97.4 bits (241), Expect = 4.0e-21 Identity = 47/64 (73.44%), Postives = 58/64 (90.62%), Query Frame = 0
BLAST of Bhi10G001164 vs. TAIR10
Match: AT2G14210.1 (AGAMOUS-like 44) HSP 1 Score: 85.5 bits (210), Expect = 1.6e-17 Identity = 40/60 (66.67%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of Bhi10G001164 vs. TAIR10
Match: AT5G13790.1 (AGAMOUS-like 15) HSP 1 Score: 84.0 bits (206), Expect = 4.5e-17 Identity = 38/63 (60.32%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Bhi10G001164 vs. TAIR10
Match: AT5G51870.3 (AGAMOUS-like 71) HSP 1 Score: 83.6 bits (205), Expect = 5.9e-17 Identity = 44/79 (55.70%), Postives = 61/79 (77.22%), Query Frame = 0
BLAST of Bhi10G001164 vs. Swiss-Prot
Match: sp|Q9FUY6|JOIN_SOLLC (MADS-box protein JOINTLESS OS=Solanum lycopersicum OX=4081 GN=J PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-20 Identity = 48/63 (76.19%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. Swiss-Prot
Match: sp|Q9FVC1|SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana OX=3702 GN=SVP PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-20 Identity = 49/63 (77.78%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of Bhi10G001164 vs. Swiss-Prot
Match: sp|O82794|AGL24_ARATH (MADS-box protein AGL24 OS=Arabidopsis thaliana OX=3702 GN=AGL24 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 7.2e-20 Identity = 47/64 (73.44%), Postives = 58/64 (90.62%), Query Frame = 0
BLAST of Bhi10G001164 vs. Swiss-Prot
Match: sp|Q6EP49|MAD27_ORYSJ (MADS-box transcription factor 27 OS=Oryza sativa subsp. japonica OX=39947 GN=MADS27 PE=2 SV=2) HSP 1 Score: 87.8 bits (216), Expect = 5.7e-17 Identity = 42/64 (65.62%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Bhi10G001164 vs. Swiss-Prot
Match: sp|Q6Z6W2|MAD57_ORYSJ (MADS-box transcription factor 57 OS=Oryza sativa subsp. japonica OX=39947 GN=MADS57 PE=1 SV=2) HSP 1 Score: 85.9 bits (211), Expect = 2.2e-16 Identity = 41/63 (65.08%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Bhi10G001164 vs. TrEMBL
Match: tr|A0A1S3B1C2|A0A1S3B1C2_CUCME (MADS-box protein SVP-like OS=Cucumis melo OX=3656 GN=LOC103484931 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 5.3e-20 Identity = 53/63 (84.13%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of Bhi10G001164 vs. TrEMBL
Match: tr|A0A2N9J032|A0A2N9J032_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS57665 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 9.1e-20 Identity = 51/62 (82.26%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of Bhi10G001164 vs. TrEMBL
Match: tr|A0A1S3VP04|A0A1S3VP04_VIGRR (MADS-box protein JOINTLESS OS=Vigna radiata var. radiata OX=3916 GN=LOC106776949 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.0e-19 Identity = 52/63 (82.54%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. TrEMBL
Match: tr|A0A0L9T7J0|A0A0L9T7J0_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan284s001900 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.6e-19 Identity = 51/63 (80.95%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. TrEMBL
Match: tr|A0A0S3T3N8|A0A0S3T3N8_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.10G090300 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.6e-19 Identity = 51/63 (80.95%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. NCBI nr
Match: XP_022962900.1 (MADS-box protein JOINTLESS-like [Cucurbita moschata] >XP_022962901.1 MADS-box protein JOINTLESS-like [Cucurbita moschata]) HSP 1 Score: 107.5 bits (267), Expect = 2.1e-20 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. NCBI nr
Match: XP_023003989.1 (MADS-box protein JOINTLESS-like [Cucurbita maxima]) HSP 1 Score: 107.5 bits (267), Expect = 2.1e-20 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. NCBI nr
Match: XP_023517620.1 (MADS-box protein JOINTLESS-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.5 bits (267), Expect = 2.1e-20 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi10G001164 vs. NCBI nr
Match: XP_004143442.1 (PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis sativus] >XP_011657947.1 PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis sativus]) HSP 1 Score: 105.5 bits (262), Expect = 8.0e-20 Identity = 53/63 (84.13%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of Bhi10G001164 vs. NCBI nr
Match: XP_008440538.1 (PREDICTED: MADS-box protein SVP-like [Cucumis melo] >XP_008440540.1 PREDICTED: MADS-box protein SVP-like [Cucumis melo]) HSP 1 Score: 105.5 bits (262), Expect = 8.0e-20 Identity = 53/63 (84.13%), Postives = 58/63 (92.06%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|