Bhi09G002178 (gene) Wax gourd
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ACTAGGAATTGAATCATTATGGCAAGGAAAAGTTTAATTCAGAGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCTTTAAAAAAAGAAATAAGCAAAGTTCCATCGTTGAGTGAGAAATGGGAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTTTCATCGACGTTGTTTTTTAACCGGAAGACCGAGAGCTAACTATCGAGATTTGGGCTCTCTGGACACATACTTCGTGAATGGTTCATGCATGCTTGTTGCCTGGGCAACAAAATCAAGTTGGTAAGGATTCAAATATCCCTTTCTATTCATTTCTATGATCATAGAGG ACTAGGAATTGAATCATTATGGCAAGGAAAAGTTTAATTCAGAGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCTTTAAAAAAAGAAATAAGCAAAGTTCCATCGTTGAGTGAGAAATGGGAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTTTCATCGACGTTGTTTTTTAACCGGAAGACCGAGAGCTAACTATCGAGATTTGGGCTCTCTGGACACATACTTCGTGAATGGTTCATGCATGCTTGTTGCCTGGGCAACAAAATCAAGTTGGTAAGGATTCAAATATCCCTTTCTATTCATTTCTATGATCATAGAGG ATGGCAAGGAAAAGTTTAATTCAGAGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCTTTAAAAAAAGAAATAAGCAAAGTTCCATCGTTGAGTGAGAAATGGGAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTTTCATCGACGTTGTTTTTTAA MARKSLIQREKKRQKLEQKYHLIRRSLKKEISKVPSLSEKWEIHGKLQSPPRNSAPTRFIDVVF
BLAST of Bhi09G002178 vs. Swiss-Prot
Match: sp|Q4VZN5|RR14_CUCSA (30S ribosomal protein S14, chloroplastic OS=Cucumis sativus OX=3659 GN=rps14 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.4e-23 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Bhi09G002178 vs. Swiss-Prot
Match: sp|Q14FF9|RR14_POPAL (30S ribosomal protein S14, chloroplastic OS=Populus alba OX=43335 GN=rps14 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.4e-23 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Bhi09G002178 vs. Swiss-Prot
Match: sp|A4GYQ8|RR14_POPTR (30S ribosomal protein S14, chloroplastic OS=Populus trichocarpa OX=3694 GN=rps14 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.4e-23 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Bhi09G002178 vs. Swiss-Prot
Match: sp|B1NWE8|RR14_MANES (30S ribosomal protein S14, chloroplastic OS=Manihot esculenta OX=3983 GN=rps14 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 7.5e-23 Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Bhi09G002178 vs. Swiss-Prot
Match: sp|A6MM34|RR14_BUXMI (30S ribosomal protein S14, chloroplastic OS=Buxus microphylla OX=153571 GN=rps14 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 9.8e-23 Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Bhi09G002178 vs. TAIR10
Match: ATCG00330.1 (chloroplast ribosomal protein S14) HSP 1 Score: 102.4 bits (254), Expect = 1.0e-22 Identity = 52/58 (89.66%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of Bhi09G002178 vs. TrEMBL
Match: tr|X2F792|X2F792_LAGSI (30S ribosomal protein S14, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rps14 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.2e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. TrEMBL
Match: tr|X2F0X5|X2F0X5_LAGSI (30S ribosomal protein S14, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rps14 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.2e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. TrEMBL
Match: tr|A0A1P8LDH3|A0A1P8LDH3_CITLA (Ribosomal protein S14 OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=rps14 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.2e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. TrEMBL
Match: tr|A0A1P8LE66|A0A1P8LE66_9ROSI (Ribosomal protein S14 OS=Citrullus mucosospermus OX=519315 GN=rps14 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.2e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. TrEMBL
Match: tr|A0A0S2IEZ4|A0A0S2IEZ4_9ROSI (Ribosomal protein S14 OS=Cucurbita foetidissima OX=184136 GN=rps14 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.2e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. NCBI nr
Match: AHM88717.1 (ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM88776.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM88834.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89007.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89243.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89302.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89421.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89539.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90012.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90248.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90307.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90425.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90661.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM91015.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM91074.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM91132.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM91192.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM91250.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM91307.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 111.7 bits (278), Expect = 9.3e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. NCBI nr
Match: YP_009317384.1 (ribosomal protein S14 (chloroplast) [Coccinia grandis] >YP_009325987.1 ribosomal protein S14 (chloroplast) [Citrullus lanatus] >YP_009348029.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >YP_009420792.1 ribosomal protein S14 (chloroplast) [Citrullus colocynthis] >YP_009431555.1 ribosomal protein S14 (chloroplast) [Citrullus amarus] >YP_009431640.1 ribosomal protein S14 (chloroplast) [Citrullus rehmii] >YP_009456144.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89066.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89125.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89184.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89362.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89480.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89599.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89658.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89717.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89776.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89835.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89894.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89953.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90071.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90130.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90189.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90366.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90484.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90543.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90602.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90720.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90779.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90838.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90897.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90956.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AOX48768.1 ribosomal protein S14 (chloroplast) [Coccinia grandis] >AOX48853.1 ribosomal protein S14 (chloroplast) [Coccinia grandis] >APD52478.1 ribosomal protein S14 (chloroplast) [Citrullus lanatus] >APW82459.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82544.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82629.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82714.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >APW82799.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >APW82884.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82969.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83054.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83139.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83224.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83309.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >ASP44511.1 ribosomal protein S14 (chloroplast) [Citrullus colocynthis] >ASY96203.1 ribosomal protein S14 (chloroplast) [Citrullus amarus] >ASY96292.1 ribosomal protein S14 (chloroplast) [Citrullus rehmii] >AUJ21910.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AXR94574.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa] >AXR94660.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa] >AXR94743.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa] >AXR94829.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 111.7 bits (278), Expect = 9.3e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. NCBI nr
Match: ALO21952.1 (ribosomal protein S14 (plastid) [Cucurbita cordata] >ALO22013.1 ribosomal protein S14 (plastid) [Cucurbita digitata] >ALO22112.1 ribosomal protein S14 (plastid) [Cucurbita ficifolia] >ALO22174.1 ribosomal protein S14 (plastid) [Cucurbita foetidissima] >ALO22913.1 ribosomal protein S14 (plastid) [Cucurbita pedatifolia]) HSP 1 Score: 111.7 bits (278), Expect = 9.3e-22 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. NCBI nr
Match: YP_008081363.1 (ribosomal protein S14 (chloroplast) [Tetracentron sinense] >AGJ72055.1 ribosomal protein S14 (chloroplast) [Tetracentron sinense]) HSP 1 Score: 110.5 bits (275), Expect = 2.1e-21 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Bhi09G002178 vs. NCBI nr
Match: YP_009309959.1 (ribosomal protein S14 (chloroplast) [Coreanomecon hylomeconoides] >ALZ50102.1 ribosomal protein S14 (chloroplast) [Coreanomecon hylomeconoides] >AXR90983.1 ribosomal protein S14 (chloroplast) [Macleaya microcarpa] >AXR91068.1 ribosomal protein S14 (chloroplast) [Macleaya microcarpa] >AXR91152.1 ribosomal protein S14 (chloroplast) [Macleaya microcarpa] >AXR91237.1 ribosomal protein S14 (chloroplast) [Macleaya microcarpa]) HSP 1 Score: 110.5 bits (275), Expect = 2.1e-21 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |