Bhi09G001751 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGATAGTGGTGGGAAAGAGATTTGGCTCGAATTTTGATGGCAGTGGCCGGGAACAATATGGAGAGGCGTTGAAAAATGTTATTTATCTGTTAGGGGAATTTATTCCTTCGAATTCGTTTCCACTTATAAGTTGGTTGGATTTGGAAGGGTATAAGAAGGCCATGAAGAAGACGGTGAAGGTGTTGGATTGGGTGCTTGATAAATGGATCGAAGAGTATCAAGAAATAAAGAAGAAAAAGAATGACAACGAAAGAAAGGAGGAAGATTTCATAGATGTCGTGCTTTCTACTGTCGAACATCATGAATAG ATGAAGATAGTGGTGGGAAAGAGATTTGGCTCGAATTTTGATGGCAGTGGCCGGGAACAATATGGAGAGGCGTTGAAAAATGTTATTTATCTGTTAGGGGAATTTATTCCTTCGAATTCGTTTCCACTTATAAGTTGGTTGGATTTGGAAGGGTATAAGAAGGCCATGAAGAAGACGGTGAAGGTGTTGGATTGGGTGCTTGATAAATGGATCGAAGAGTATCAAGAAATAAAGAAGAAAAAGAATGACAACGAAAGAAAGGAGGAAGATTTCATAGATGTCGTGCTTTCTACTGTCGAACATCATGAATAG ATGAAGATAGTGGTGGGAAAGAGATTTGGCTCGAATTTTGATGGCAGTGGCCGGGAACAATATGGAGAGGCGTTGAAAAATGTTATTTATCTGTTAGGGGAATTTATTCCTTCGAATTCGTTTCCACTTATAAGTTGGTTGGATTTGGAAGGGTATAAGAAGGCCATGAAGAAGACGGTGAAGGTGTTGGATTGGGTGCTTGATAAATGGATCGAAGAGTATCAAGAAATAAAGAAGAAAAAGAATGACAACGAAAGAAAGGAGGAAGATTTCATAGATGTCGTGCTTTCTACTGTCGAACATCATGAATAG MKIVVGKRFGSNFDGSGREQYGEALKNVIYLLGEFIPSNSFPLISWLDLEGYKKAMKKTVKVLDWVLDKWIEEYQEIKKKKNDNERKEEDFIDVVLSTVEHHE
BLAST of Bhi09G001751 vs. Swiss-Prot
Match: sp|O49396|C82C3_ARATH (Cytochrome P450 82C3 OS=Arabidopsis thaliana OX=3702 GN=CYP82C3 PE=2 SV=3) HSP 1 Score: 75.1 bits (183), Expect = 5.1e-13 Identity = 39/109 (35.78%), Postives = 68/109 (62.39%), Query Frame = 0
BLAST of Bhi09G001751 vs. Swiss-Prot
Match: sp|H2DH24|C7D47_PANGI (Cytochrome P450 CYP82D47 OS=Panax ginseng OX=4054 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.7e-13 Identity = 37/104 (35.58%), Postives = 65/104 (62.50%), Query Frame = 0
BLAST of Bhi09G001751 vs. Swiss-Prot
Match: sp|O49394|C82C2_ARATH (Cytochrome P450 82C2 OS=Arabidopsis thaliana OX=3702 GN=CYP82C2 PE=2 SV=2) HSP 1 Score: 69.7 bits (169), Expect = 2.1e-11 Identity = 37/105 (35.24%), Postives = 65/105 (61.90%), Query Frame = 0
BLAST of Bhi09G001751 vs. Swiss-Prot
Match: sp|Q9SZ46|C82C4_ARATH (Cytochrome P450 82C4 OS=Arabidopsis thaliana OX=3702 GN=CYP82C4 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-10 Identity = 38/106 (35.85%), Postives = 67/106 (63.21%), Query Frame = 0
BLAST of Bhi09G001751 vs. Swiss-Prot
Match: sp|Q43068|C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum OX=3888 GN=CYP82A1 PE=2 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-10 Identity = 38/102 (37.25%), Postives = 61/102 (59.80%), Query Frame = 0
BLAST of Bhi09G001751 vs. TAIR10
Match: AT4G31950.1 (cytochrome P450, family 82, subfamily C, polypeptide 3) HSP 1 Score: 75.1 bits (183), Expect = 2.8e-14 Identity = 39/109 (35.78%), Postives = 68/109 (62.39%), Query Frame = 0
BLAST of Bhi09G001751 vs. TAIR10
Match: AT4G31970.1 (cytochrome P450, family 82, subfamily C, polypeptide 2) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-12 Identity = 37/105 (35.24%), Postives = 65/105 (61.90%), Query Frame = 0
BLAST of Bhi09G001751 vs. TAIR10
Match: AT4G31940.1 (cytochrome P450, family 82, subfamily C, polypeptide 4) HSP 1 Score: 67.0 bits (162), Expect = 7.7e-12 Identity = 38/106 (35.85%), Postives = 67/106 (63.21%), Query Frame = 0
BLAST of Bhi09G001751 vs. TAIR10
Match: AT2G25160.1 (cytochrome P450, family 82, subfamily F, polypeptide 1) HSP 1 Score: 51.6 bits (122), Expect = 3.3e-07 Identity = 33/99 (33.33%), Postives = 60/99 (60.61%), Query Frame = 0
BLAST of Bhi09G001751 vs. TAIR10
Match: AT4G12310.1 (cytochrome P450, family 706, subfamily A, polypeptide 5) HSP 1 Score: 42.7 bits (99), Expect = 1.6e-04 Identity = 26/88 (29.55%), Postives = 44/88 (50.00%), Query Frame = 0
BLAST of Bhi09G001751 vs. TrEMBL
Match: tr|A0A0A0LDQ7|A0A0A0LDQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G853160 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 4.6e-19 Identity = 48/102 (47.06%), Postives = 73/102 (71.57%), Query Frame = 0
BLAST of Bhi09G001751 vs. TrEMBL
Match: tr|A0A0A0LG08|A0A0A0LG08_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G853170 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.3e-18 Identity = 53/110 (48.18%), Postives = 76/110 (69.09%), Query Frame = 0
BLAST of Bhi09G001751 vs. TrEMBL
Match: tr|A0A1S3CT10|A0A1S3CT10_CUCME (cytochrome P450 CYP82D47-like OS=Cucumis melo OX=3656 GN=LOC103503993 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 3.0e-18 Identity = 54/110 (49.09%), Postives = 74/110 (67.27%), Query Frame = 0
BLAST of Bhi09G001751 vs. TrEMBL
Match: tr|A0A1S3CM83|A0A1S3CM83_CUCME (cytochrome P450 CYP82D47-like OS=Cucumis melo OX=3656 GN=LOC103502578 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.9e-17 Identity = 47/102 (46.08%), Postives = 69/102 (67.65%), Query Frame = 0
BLAST of Bhi09G001751 vs. TrEMBL
Match: tr|A0A0A0LG04|A0A0A0LG04_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G852630 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 3.3e-17 Identity = 49/101 (48.51%), Postives = 69/101 (68.32%), Query Frame = 0
BLAST of Bhi09G001751 vs. NCBI nr
Match: XP_022137230.1 (cytochrome P450 CYP82D47-like [Momordica charantia]) HSP 1 Score: 120.6 bits (301), Expect = 3.2e-24 Identity = 59/99 (59.60%), Postives = 78/99 (78.79%), Query Frame = 0
BLAST of Bhi09G001751 vs. NCBI nr
Match: XP_022935737.1 (cytochrome P450 CYP82D47-like [Cucurbita moschata]) HSP 1 Score: 119.8 bits (299), Expect = 5.5e-24 Identity = 60/104 (57.69%), Postives = 77/104 (74.04%), Query Frame = 0
BLAST of Bhi09G001751 vs. NCBI nr
Match: XP_022935744.1 (cytochrome P450 CYP82D47-like [Cucurbita moschata]) HSP 1 Score: 119.0 bits (297), Expect = 9.4e-24 Identity = 58/104 (55.77%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of Bhi09G001751 vs. NCBI nr
Match: XP_023535448.1 (cytochrome P450 CYP82D47-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 118.6 bits (296), Expect = 1.2e-23 Identity = 58/104 (55.77%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of Bhi09G001751 vs. NCBI nr
Match: XP_022975796.1 (cytochrome P450 82A3-like [Cucurbita maxima]) HSP 1 Score: 116.3 bits (290), Expect = 6.1e-23 Identity = 57/100 (57.00%), Postives = 76/100 (76.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|