Bhi09G001492 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGTGCTCTAGGCACCCCCATTTAGAAAGAAGGGTCGAAGGTTTTGGGCCTGTAGCTTTCCCCGTCCGCCCTTCGTCGGGTGGTGCTTGTGTGTGGGGTGTGCTACCAGAAATCGGGCTTGAAGCTCTCGCCTTACCAACGTGCCGATAG ATGGGGTGCTCTAGGCACCCCCATTTAGAAAGAAGGGTCGAAGGTTTTGGGCCTGTAGCTTTCCCCGTCCGCCCTTCGTCGGGTGGTGCTTGTGTGTGGGGTGTGCTACCAGAAATCGGGCTTGAAGCTCTCGCCTTACCAACGTGCCGATAG ATGGGGTGCTCTAGGCACCCCCATTTAGAAAGAAGGGTCGAAGGTTTTGGGCCTGTAGCTTTCCCCGTCCGCCCTTCGTCGGGTGGTGCTTGTGTGTGGGGTGTGCTACCAGAAATCGGGCTTGAAGCTCTCGCCTTACCAACGTGCCGATAG MGCSRHPHLERRVEGFGPVAFPVRPSSGGACVWGVLPEIGLEALALPTCR
BLAST of Bhi09G001492 vs. Swiss-Prot
Match: sp|P93286|CCMFC_ARATH (Cytochrome c biogenesis CcmF C-terminal-like mitochondrial protein OS=Arabidopsis thaliana OX=3702 GN=CCMFC PE=1 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-15 Identity = 40/52 (76.92%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi09G001492 vs. TAIR10
Match: ATMG00180.1 (cytochrome C biogenesis 452) HSP 1 Score: 80.9 bits (198), Expect = 2.5e-16 Identity = 40/52 (76.92%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi09G001492 vs. TrEMBL
Match: tr|D5I3C4|D5I3C4_CITLA (Cytochrome c biogenesis FC OS=Citrullus lanatus OX=3654 GN=ccmFc PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 47/50 (94.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. TrEMBL
Match: tr|G3EU31|G3EU31_CUCME (Cytochrome c biogenesis FC OS=Cucumis melo subsp. melo OX=412675 GN=ccmFc PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.6e-17 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. TrEMBL
Match: tr|G3EIX3|G3EIX3_CUCSA (Cytochrome c biogenesis FC OS=Cucumis sativus OX=3659 GN=ccmFc PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.6e-17 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. TrEMBL
Match: tr|D5I3F3|D5I3F3_CUCPE (Cytochrome c biogenesis FC OS=Cucurbita pepo OX=3663 GN=ccmFc PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.3e-16 Identity = 44/50 (88.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. TrEMBL
Match: tr|A0A142BZ14|A0A142BZ14_ZIZJJ (Cytochrome c biogenesis FC OS=Ziziphus jujuba OX=326968 GN=ccmFc PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.3e-16 Identity = 44/50 (88.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. NCBI nr
Match: YP_003587254.1 (cytochrome c biogenesis FC [Citrullus lanatus] >ACV96627.1 cytochrome c biogenesis FC (mitochondrion) [Citrullus lanatus]) HSP 1 Score: 103.6 bits (257), Expect = 2.0e-19 Identity = 47/50 (94.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. NCBI nr
Match: YP_004849321.1 (cytochrome c biogenesis FC (mitochondrion) [Cucumis sativus] >ADZ10748.1 cytochrome c biogenesis FC (mitochondrion) [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 2.4e-17 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. NCBI nr
Match: AEN56115.1 (cytochrome c biogenesis FC (mitochondrion) [Cucumis melo subsp. melo]) HSP 1 Score: 96.7 bits (239), Expect = 2.4e-17 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. NCBI nr
Match: YP_003587367.1 (cytochrome c biogenesis FC [Cucurbita pepo] >ACV96669.1 cytochrome c biogenesis FC (mitochondrion) [Cucurbita pepo]) HSP 1 Score: 92.8 bits (229), Expect = 3.5e-16 Identity = 44/50 (88.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Bhi09G001492 vs. NCBI nr
Match: YP_009241673.1 (cytochrome c biogenesis FC (mitochondrion) [Ziziphus jujuba] >AMP43658.1 cytochrome c biogenesis FC (mitochondrion) [Ziziphus jujuba]) HSP 1 Score: 92.8 bits (229), Expect = 3.5e-16 Identity = 44/50 (88.00%), Postives = 44/50 (88.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|