Bhi09G000788 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCGCAATATCCAGTCCCAAAATGGGCTTCCACGCCTTGTATAATGGGCATCGATGAAGCTGGTGGAGGCCCTATTTTAGGTTTTCTATGTTCCTATTCGTTTCGTTCCATTTCTGCCTCTTTAATTCCGCTTCGATCATCATATTTTGGGATATGATTTTGAATACTCTTTTCTTTATGAAATATCACTACATTTGATGATCTCAGGGACAATGGTGTATGGATGCTTGTACTGCGCCAGTTCATATTTGAAAGAACTTTCGTCTTTGATTTTTGCAGGTTTAGCTTCTTGCTCCTATGATTTTCTTTTAACTGTTGTTCATCATATCTCTATTTCGTTTACTTTTCTTCCAACTTGTGATGTGTTGCCTTTAGACTCAAAAACTTTGAAAGAAGAGAAGAAGGAGGAATTGTTTGAAGATTTGAAGTCTAACGAGACAATTGGATGGGCTGTTAATGTCATAGATCCTCGAGAACTTTCATCTAAAATGCTAAATAAGTCAATCTTCAGTGGTTTATAA ATGTCTTCGCAATATCCAGTCCCAAAATGGGCTTCCACGCCTTGTATAATGGGCATCGATGAAGCTGGTGGAGGCCCTATTTTAGGGACAATGGTGTATGGATGCTTGTACTGCGCCAGTTCATATTTGAAAGAACTTTCGTCTTTGATTTTTGCAGGTTTAGCTTCTTGCTCCTATGATTTTCTTTTAACTGTTGTTCATCATATCTCTATTTCGTTTACTTTTCTTCCAACTTGTGATGTGTTGCCTTTAGACTCAAAAACTTTGAAAGAAGAGAAGAAGGAGGAATTGTTTGAAGATTTGAAGTCTAACGAGACAATTGGATGGGCTGTTAATGTCATAGATCCTCGAGAACTTTCATCTAAAATGCTAAATAAGTCAATCTTCAGTGGTTTATAA ATGTCTTCGCAATATCCAGTCCCAAAATGGGCTTCCACGCCTTGTATAATGGGCATCGATGAAGCTGGTGGAGGCCCTATTTTAGGGACAATGGTGTATGGATGCTTGTACTGCGCCAGTTCATATTTGAAAGAACTTTCGTCTTTGATTTTTGCAGGTTTAGCTTCTTGCTCCTATGATTTTCTTTTAACTGTTGTTCATCATATCTCTATTTCGTTTACTTTTCTTCCAACTTGTGATGTGTTGCCTTTAGACTCAAAAACTTTGAAAGAAGAGAAGAAGGAGGAATTGTTTGAAGATTTGAAGTCTAACGAGACAATTGGATGGGCTGTTAATGTCATAGATCCTCGAGAACTTTCATCTAAAATGCTAAATAAGTCAATCTTCAGTGGTTTATAA MSSQYPVPKWASTPCIMGIDEAGGGPILGTMVYGCLYCASSYLKELSSLIFAGLASCSYDFLLTVVHHISISFTFLPTCDVLPLDSKTLKEEKKEELFEDLKSNETIGWAVNVIDPRELSSKMLNKSIFSGL
BLAST of Bhi09G000788 vs. Swiss-Prot
Match: sp|Q9SEZ6|RNH2A_ARATH (Ribonuclease H2 subunit A OS=Arabidopsis thaliana OX=3702 GN=At2g25100 PE=2 SV=2) HSP 1 Score: 121.3 bits (303), Expect = 7.9e-27 Identity = 64/127 (50.39%), Postives = 79/127 (62.20%), Query Frame = 0
BLAST of Bhi09G000788 vs. Swiss-Prot
Match: sp|O75792|RNH2A_HUMAN (Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2) HSP 1 Score: 68.9 bits (167), Expect = 4.7e-11 Identity = 40/122 (32.79%), Postives = 58/122 (47.54%), Query Frame = 0
BLAST of Bhi09G000788 vs. Swiss-Prot
Match: sp|Q2TBT5|RNH2A_BOVIN (Ribonuclease H2 subunit A OS=Bos taurus OX=9913 GN=RNASEH2A PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 6.1e-11 Identity = 41/127 (32.28%), Postives = 63/127 (49.61%), Query Frame = 0
BLAST of Bhi09G000788 vs. Swiss-Prot
Match: sp|Q9CWY8|RNH2A_MOUSE (Ribonuclease H2 subunit A OS=Mus musculus OX=10090 GN=Rnaseh2a PE=1 SV=2) HSP 1 Score: 67.0 bits (162), Expect = 1.8e-10 Identity = 41/123 (33.33%), Postives = 60/123 (48.78%), Query Frame = 0
BLAST of Bhi09G000788 vs. Swiss-Prot
Match: sp|Q5U209|RNH2A_RAT (Ribonuclease H2 subunit A OS=Rattus norvegicus OX=10116 GN=Rnaseh2a PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 2.3e-10 Identity = 40/123 (32.52%), Postives = 60/123 (48.78%), Query Frame = 0
BLAST of Bhi09G000788 vs. TAIR10
Match: AT2G25100.1 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein) HSP 1 Score: 121.3 bits (303), Expect = 4.4e-28 Identity = 64/127 (50.39%), Postives = 79/127 (62.20%), Query Frame = 0
BLAST of Bhi09G000788 vs. TrEMBL
Match: tr|A0A1S3BXP1|A0A1S3BXP1_CUCME (Ribonuclease OS=Cucumis melo OX=3656 GN=LOC103494542 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 5.5e-33 Identity = 80/126 (63.49%), Postives = 87/126 (69.05%), Query Frame = 0
BLAST of Bhi09G000788 vs. TrEMBL
Match: tr|A0A0A0KTZ4|A0A0A0KTZ4_CUCSA (Ribonuclease OS=Cucumis sativus OX=3659 GN=Csa_4G015800 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 7.2e-33 Identity = 79/126 (62.70%), Postives = 87/126 (69.05%), Query Frame = 0
BLAST of Bhi09G000788 vs. TrEMBL
Match: tr|A0A0B0NKK6|A0A0B0NKK6_GOSAR (Ribonuclease OS=Gossypium arboreum OX=29729 GN=F383_18865 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 5.7e-30 Identity = 73/127 (57.48%), Postives = 86/127 (67.72%), Query Frame = 0
BLAST of Bhi09G000788 vs. TrEMBL
Match: tr|A0A1U8J799|A0A1U8J799_GOSHI (Ribonuclease OS=Gossypium hirsutum OX=3635 GN=LOC107904365 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 5.7e-30 Identity = 73/127 (57.48%), Postives = 86/127 (67.72%), Query Frame = 0
BLAST of Bhi09G000788 vs. TrEMBL
Match: tr|A0A2P5W9S1|A0A2P5W9S1_GOSBA (Ribonuclease OS=Gossypium barbadense OX=3634 GN=GOBAR_AA32881 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 5.7e-30 Identity = 73/127 (57.48%), Postives = 86/127 (67.72%), Query Frame = 0
BLAST of Bhi09G000788 vs. NCBI nr
Match: XP_022145114.1 (ribonuclease H2 subunit A [Momordica charantia]) HSP 1 Score: 152.1 bits (383), Expect = 1.3e-33 Identity = 80/126 (63.49%), Postives = 89/126 (70.63%), Query Frame = 0
BLAST of Bhi09G000788 vs. NCBI nr
Match: XP_008453982.1 (PREDICTED: ribonuclease H2 subunit A isoform X1 [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 8.3e-33 Identity = 80/126 (63.49%), Postives = 87/126 (69.05%), Query Frame = 0
BLAST of Bhi09G000788 vs. NCBI nr
Match: XP_004152096.1 (PREDICTED: ribonuclease H2 subunit A [Cucumis sativus] >KGN53090.1 hypothetical protein Csa_4G015800 [Cucumis sativus]) HSP 1 Score: 149.1 bits (375), Expect = 1.1e-32 Identity = 79/126 (62.70%), Postives = 87/126 (69.05%), Query Frame = 0
BLAST of Bhi09G000788 vs. NCBI nr
Match: XP_022979887.1 (ribonuclease H2 subunit A [Cucurbita maxima]) HSP 1 Score: 148.7 bits (374), Expect = 1.4e-32 Identity = 79/126 (62.70%), Postives = 86/126 (68.25%), Query Frame = 0
BLAST of Bhi09G000788 vs. NCBI nr
Match: XP_023527419.1 (ribonuclease H2 subunit A [Cucurbita pepo subsp. pepo]) HSP 1 Score: 148.7 bits (374), Expect = 1.4e-32 Identity = 79/126 (62.70%), Postives = 86/126 (68.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|