Bhi09G000374 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGAGCCGGAGGTCACATTTATGTCAAGGACTAAAGAAGATGAATGTTTGATTGTGGCAAATGATGGAGTAGGGGATGTCTTGTCTAATGAAGATGTGATGAAGATGGCGTGTGGCATACTAAGGAGGCGACGCAGGAAGTTGGTGTTTGGTGGAACTCGCATGATCCAATTTCTCCAGCACAATATGCTGCAAATCAAATTAGTAAG ATGTTGGAGCCGGAGGTCACATTTATGTCAAGGACTAAAGAAGATGAATGTTTGATTGTGGCAAATGATGGAGTAGGGGATGTCTTGTCTAATGAAGATGAAGTTGGTGTTTGGTGGAACTCGCATGATCCAATTTCTCCAGCACAATATGCTGCAAATCAAATTAGTAAG ATGTTGGAGCCGGAGGTCACATTTATGTCAAGGACTAAAGAAGATGAATGTTTGATTGTGGCAAATGATGGAGTAGGGGATGTCTTGTCTAATGAAGATGAAGTTGGTGTTTGGTGGAACTCGCATGATCCAATTTCTCCAGCACAATATGCTGCAAATCAAATTAGTAAG MLEPEVTFMSRTKEDECLIVANDGVGDVLSNEDEVGVWWNSHDPISPAQYAANQISK
BLAST of Bhi09G000374 vs. Swiss-Prot
Match: sp|Q9CAJ0|P2C16_ARATH (Protein phosphatase 2C 16 OS=Arabidopsis thaliana OX=3702 GN=HAB1 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.3e-05 Identity = 20/31 (64.52%), Postives = 29/31 (93.55%), Query Frame = 0
BLAST of Bhi09G000374 vs. Swiss-Prot
Match: sp|Q9LNP9|P2C07_ARATH (Protein phosphatase 2C 7 OS=Arabidopsis thaliana OX=3702 GN=HAB2 PE=1 SV=2) HSP 1 Score: 49.3 bits (116), Expect = 1.7e-05 Identity = 20/31 (64.52%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi09G000374 vs. Swiss-Prot
Match: sp|Q5N9N2|P2C09_ORYSJ (Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0846300 PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 1.4e-04 Identity = 23/49 (46.94%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of Bhi09G000374 vs. Swiss-Prot
Match: sp|P49598|P2C37_ARATH (Protein phosphatase 2C 37 OS=Arabidopsis thaliana OX=3702 GN=PP2CA PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 1.4e-04 Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 0
BLAST of Bhi09G000374 vs. Swiss-Prot
Match: sp|Q0JLP9|P2C06_ORYSJ (Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C06 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 1.8e-04 Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of Bhi09G000374 vs. TAIR10
Match: AT1G72770.1 (HYPERSENSITIVE TO ABA1) HSP 1 Score: 49.7 bits (117), Expect = 7.0e-07 Identity = 20/31 (64.52%), Postives = 29/31 (93.55%), Query Frame = 0
BLAST of Bhi09G000374 vs. TAIR10
Match: AT1G17550.1 (homology to ABI2) HSP 1 Score: 49.3 bits (116), Expect = 9.2e-07 Identity = 20/31 (64.52%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi09G000374 vs. TAIR10
Match: AT3G11410.1 (protein phosphatase 2CA) HSP 1 Score: 46.2 bits (108), Expect = 7.8e-06 Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 0
BLAST of Bhi09G000374 vs. TAIR10
Match: AT5G57050.1 (Protein phosphatase 2C family protein) HSP 1 Score: 44.7 bits (104), Expect = 2.3e-05 Identity = 18/31 (58.06%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of Bhi09G000374 vs. TAIR10
Match: AT4G26080.1 (Protein phosphatase 2C family protein) HSP 1 Score: 44.3 bits (103), Expect = 3.0e-05 Identity = 18/31 (58.06%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of Bhi09G000374 vs. TrEMBL
Match: tr|M0SHZ3|M0SHZ3_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis OX=214687 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.1e-05 Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Bhi09G000374 vs. TrEMBL
Match: tr|A0A2N9GC23|A0A2N9GC23_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS24683 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 8.0e-05 Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of Bhi09G000374 vs. TrEMBL
Match: tr|M4DJB7|M4DJB7_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis OX=51351 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.0e-04 Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 0
BLAST of Bhi09G000374 vs. TrEMBL
Match: tr|A0A0V0IBJ7|A0A0V0IBJ7_SOLCH (Uncharacterized protein OS=Solanum chacoense OX=4108 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.0e-04 Identity = 30/57 (52.63%), Postives = 35/57 (61.40%), Query Frame = 0
BLAST of Bhi09G000374 vs. TrEMBL
Match: tr|A0A2K1R841|A0A2K1R841_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_T063000v3 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.0e-04 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of Bhi09G000374 vs. NCBI nr
Match: XP_022148145.1 (probable protein phosphatase 2C 6 [Momordica charantia] >XP_022148163.1 probable protein phosphatase 2C 6 [Momordica charantia]) HSP 1 Score: 65.9 bits (159), Expect = 5.2e-08 Identity = 36/68 (52.94%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of Bhi09G000374 vs. NCBI nr
Match: XP_011012462.1 (PREDICTED: probable protein phosphatase 2C 6 isoform X1 [Populus euphratica]) HSP 1 Score: 58.9 bits (141), Expect = 6.4e-06 Identity = 32/62 (51.61%), Postives = 41/62 (66.13%), Query Frame = 0
BLAST of Bhi09G000374 vs. NCBI nr
Match: XP_011012464.1 (PREDICTED: probable protein phosphatase 2C 6 isoform X2 [Populus euphratica]) HSP 1 Score: 58.9 bits (141), Expect = 6.4e-06 Identity = 32/62 (51.61%), Postives = 41/62 (66.13%), Query Frame = 0
BLAST of Bhi09G000374 vs. NCBI nr
Match: XP_022964466.1 (probable protein phosphatase 2C 6 isoform X2 [Cucurbita moschata]) HSP 1 Score: 57.8 bits (138), Expect = 1.4e-05 Identity = 33/70 (47.14%), Postives = 44/70 (62.86%), Query Frame = 0
BLAST of Bhi09G000374 vs. NCBI nr
Match: XP_022964465.1 (probable protein phosphatase 2C 6 isoform X1 [Cucurbita moschata]) HSP 1 Score: 57.8 bits (138), Expect = 1.4e-05 Identity = 33/70 (47.14%), Postives = 44/70 (62.86%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|