Bhi09G000337 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACACCAGAGCAAAAGAAAAGCAACAACAATTTCATCATTTCAGTAGTAGCAGCAGTGGGTGGATTGCTTGCATTCCTCATAATTGCAGCAATCATCTATTGGATTGCTAAATCAAATAAGAAGCAACAAGGTAAGGATGTTGCTTTGACAGTGGATCCAGGCAGTTCCTTGGAGAAAAAGAGACAGCATTTCACTTATGCTCAAGTTGTGATGATGACCAACAATTTTGAGAGGATTCTTGGGAAAGGAGGATTTGGGATGGTTTACTATGGAGTTCTAGATGACACTCAAGTGGCTGTGAAGATGATTTCTCCATCAGCAGTACAAGGCTACAGTCAGTTTCAAGCAGAGGCATGTGCCTAA ATGACACCAGAGCAAAAGAAAAGCAACAACAATTTCATCATTTCAGTAGTAGCAGCAGTGGGTGGATTGCTTGCATTCCTCATAATTGCAGCAATCATCTATTGGATTGCTAAATCAAATAAGAAGCAACAAGGTAAGGATGTTGCTTTGACAGTGGATCCAGGCAGTTCCTTGGAGAAAAAGAGACAGCATTTCACTTATGCTCAAGTTGTGATGATGACCAACAATTTTGAGAGGATTCTTGGGAAAGGAGGATTTGGGATGGTTTACTATGGAGTTCTAGATGACACTCAAGTGGCTGTGAAGATGATTTCTCCATCAGCAGTACAAGGCTACAGTCAGTTTCAAGCAGAGGCATGTGCCTAA ATGACACCAGAGCAAAAGAAAAGCAACAACAATTTCATCATTTCAGTAGTAGCAGCAGTGGGTGGATTGCTTGCATTCCTCATAATTGCAGCAATCATCTATTGGATTGCTAAATCAAATAAGAAGCAACAAGGTAAGGATGTTGCTTTGACAGTGGATCCAGGCAGTTCCTTGGAGAAAAAGAGACAGCATTTCACTTATGCTCAAGTTGTGATGATGACCAACAATTTTGAGAGGATTCTTGGGAAAGGAGGATTTGGGATGGTTTACTATGGAGTTCTAGATGACACTCAAGTGGCTGTGAAGATGATTTCTCCATCAGCAGTACAAGGCTACAGTCAGTTTCAAGCAGAGGCATGTGCCTAA MTPEQKKSNNNFIISVVAAVGGLLAFLIIAAIIYWIAKSNKKQQGKDVALTVDPGSSLEKKRQHFTYAQVVMMTNNFERILGKGGFGMVYYGVLDDTQVAVKMISPSAVQGYSQFQAEACA
BLAST of Bhi09G000337 vs. Swiss-Prot
Match: sp|C0LGG6|Y5189_ARATH (Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana OX=3702 GN=At1g51890 PE=2 SV=2) HSP 1 Score: 89.4 bits (220), Expect = 3.1e-17 Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Bhi09G000337 vs. Swiss-Prot
Match: sp|Q9SI06|Y5573_ARATH (Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana OX=3702 GN=At2g04300 PE=3 SV=2) HSP 1 Score: 87.8 bits (216), Expect = 8.9e-17 Identity = 42/69 (60.87%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of Bhi09G000337 vs. Swiss-Prot
Match: sp|C0LGT5|Y5169_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana OX=3702 GN=At5g16900 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 3.4e-16 Identity = 37/63 (58.73%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of Bhi09G000337 vs. Swiss-Prot
Match: sp|Q9LIG2|RLK6_ARATH (Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana OX=3702 GN=At3g21340 PE=1 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.4e-16 Identity = 40/64 (62.50%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of Bhi09G000337 vs. Swiss-Prot
Match: sp|Q9FZB1|Y5188_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana OX=3702 GN=At1g51880 PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.4e-16 Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Bhi09G000337 vs. TAIR10
Match: AT1G51890.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 89.4 bits (220), Expect = 1.7e-18 Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Bhi09G000337 vs. TAIR10
Match: AT2G04300.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 87.8 bits (216), Expect = 4.9e-18 Identity = 42/69 (60.87%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of Bhi09G000337 vs. TAIR10
Match: AT5G16900.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 85.9 bits (211), Expect = 1.9e-17 Identity = 37/63 (58.73%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of Bhi09G000337 vs. TAIR10
Match: AT1G51880.1 (root hair specific 6) HSP 1 Score: 85.5 bits (210), Expect = 2.5e-17 Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Bhi09G000337 vs. TAIR10
Match: AT3G21340.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 85.5 bits (210), Expect = 2.5e-17 Identity = 40/64 (62.50%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of Bhi09G000337 vs. TrEMBL
Match: tr|A0A1S4E4C4|A0A1S4E4C4_CUCME (putative leucine-rich repeat receptor-like protein kinase At2g19210 OS=Cucumis melo OX=3656 GN=LOC103500808 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.1e-26 Identity = 63/74 (85.14%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of Bhi09G000337 vs. TrEMBL
Match: tr|A0A0A0K7Y5|A0A0A0K7Y5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G452180 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 2.7e-26 Identity = 63/74 (85.14%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of Bhi09G000337 vs. TrEMBL
Match: tr|A0A0A0KB14|A0A0A0KB14_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G452170 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 1.1e-24 Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of Bhi09G000337 vs. TrEMBL
Match: tr|A0A1S3CID7|A0A1S3CID7_CUCME (putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Cucumis melo OX=3656 GN=LOC103500757 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 2.5e-24 Identity = 61/81 (75.31%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of Bhi09G000337 vs. TrEMBL
Match: tr|A0A0A0K9P9|A0A0A0K9P9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G452140 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.0e-22 Identity = 57/81 (70.37%), Postives = 67/81 (82.72%), Query Frame = 0
BLAST of Bhi09G000337 vs. NCBI nr
Match: XP_016902830.1 (PREDICTED: putative leucine-rich repeat receptor-like protein kinase At2g19210 [Cucumis melo]) HSP 1 Score: 127.5 bits (319), Expect = 3.1e-26 Identity = 63/74 (85.14%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of Bhi09G000337 vs. NCBI nr
Match: KGN45563.1 (hypothetical protein Csa_7G452180 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 4.1e-26 Identity = 63/74 (85.14%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of Bhi09G000337 vs. NCBI nr
Match: XP_011659809.1 (PREDICTED: probable LRR receptor-like protein kinase At1g51890 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 4.1e-26 Identity = 63/74 (85.14%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of Bhi09G000337 vs. NCBI nr
Match: KGN45562.1 (hypothetical protein Csa_7G452170 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 1.7e-24 Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of Bhi09G000337 vs. NCBI nr
Match: XP_008462388.1 (PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 [Cucumis melo]) HSP 1 Score: 120.6 bits (301), Expect = 3.8e-24 Identity = 61/81 (75.31%), Postives = 68/81 (83.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |