Bhi08G000744 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGCTAGTGGACTAAGGCTAGGTACAAGCACTTTCAACACTTTGATAAAAGGATATGGCATTGCCGGTAAGCCTGAAGAAACTATAGAACTGCTGGACTTGATGTACAAAGAGGAAAATTTGAAACTCAATCTGAGAACTTGTAATGTACCCGTCAAAGCATGGTGTAAGAAGAAGAAAATAGCATAG ATGAAGGCTAGTGGACTAAGGCTAGGTACAAGCACTTTCAACACTTTGATAAAAGGATATGGCATTGCCGGTAAGCCTGAAGAAACTATAGAACTGCTGGACTTGATGTACAAAGAGGAAAATTTGAAACTCAATCTGAGAACTTGTAATGTACCCGTCAAAGCATGGTGTAAGAAGAAGAAAATAGCATAG ATGAAGGCTAGTGGACTAAGGCTAGGTACAAGCACTTTCAACACTTTGATAAAAGGATATGGCATTGCCGGTAAGCCTGAAGAAACTATAGAACTGCTGGACTTGATGTACAAAGAGGAAAATTTGAAACTCAATCTGAGAACTTGTAATGTACCCGTCAAAGCATGGTGTAAGAAGAAGAAAATAGCATAG MKASGLRLGTSTFNTLIKGYGIAGKPEETIELLDLMYKEENLKLNLRTCNVPVKAWCKKKKIA
BLAST of Bhi08G000744 vs. Swiss-Prot
Match: sp|Q8GZ63|PP397_ARATH (Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana OX=3702 GN=At5g25630 PE=2 SV=2) HSP 1 Score: 81.6 bits (200), Expect = 3.3e-15 Identity = 42/64 (65.62%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of Bhi08G000744 vs. TAIR10
Match: AT5G25630.2 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 81.6 bits (200), Expect = 1.8e-16 Identity = 42/64 (65.62%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of Bhi08G000744 vs. TrEMBL
Match: tr|A0A1Q3DDI4|A0A1Q3DDI4_CEPFO (PPR_1 domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_33943 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.2e-15 Identity = 40/62 (64.52%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Bhi08G000744 vs. TrEMBL
Match: tr|A0A2I0KBX4|A0A2I0KBX4_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_013613 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 6.1e-14 Identity = 39/63 (61.90%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Bhi08G000744 vs. TrEMBL
Match: tr|A0A022QNT3|A0A022QNT3_ERYGU (Uncharacterized protein OS=Erythranthe guttata OX=4155 GN=MIMGU_mgv1a006289mg PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.8e-13 Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Bhi08G000744 vs. TrEMBL
Match: tr|A0A087GD63|A0A087GD63_ARAAL (Uncharacterized protein OS=Arabis alpina OX=50452 GN=AALP_AA8G433500 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 5.2e-13 Identity = 41/64 (64.06%), Postives = 51/64 (79.69%), Query Frame = 0
BLAST of Bhi08G000744 vs. TrEMBL
Match: tr|F4JY71|F4JY71_ARATH (Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g25630 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 6.7e-13 Identity = 42/64 (65.62%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of Bhi08G000744 vs. NCBI nr
Match: GAV90534.1 (PPR_1 domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 89.4 bits (220), Expect = 4.9e-15 Identity = 40/62 (64.52%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Bhi08G000744 vs. NCBI nr
Match: PKI66028.1 (hypothetical protein CRG98_013613 [Punica granatum]) HSP 1 Score: 85.1 bits (209), Expect = 9.2e-14 Identity = 39/63 (61.90%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Bhi08G000744 vs. NCBI nr
Match: XP_021800229.1 (pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Prunus avium]) HSP 1 Score: 84.7 bits (208), Expect = 1.2e-13 Identity = 41/62 (66.13%), Postives = 51/62 (82.26%), Query Frame = 0
BLAST of Bhi08G000744 vs. NCBI nr
Match: EYU29264.1 (hypothetical protein MIMGU_mgv1a006289mg [Erythranthe guttata]) HSP 1 Score: 83.6 bits (205), Expect = 2.7e-13 Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Bhi08G000744 vs. NCBI nr
Match: KFK27815.1 (hypothetical protein AALP_AA8G433500 [Arabis alpina]) HSP 1 Score: 82.0 bits (201), Expect = 7.8e-13 Identity = 41/64 (64.06%), Postives = 51/64 (79.69%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|