Bhi07G000890 (gene) Wax gourd
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CCATTTCTGGTGGGGTTCTTCGAATTCTAAGAAGAAAAGTCACTGGTTAAGCTGGGATAAGTTGTGCTTGCTTAAAGTATTTGGTGGCCTTAACTTCAAGGATATCAATCTTTTCAATCAAGCCCTTCTAGCCAAGCAAGCTTGGAACTTATTAACTAAGACTTAA CCATTTCTGGTGGGGTTCTTCGAATTCTAAGAAGAAAAGTCACTGGTTAAGCTGGGATAAGTTGTGCTTGCTTAAAGTATTTGGTGGCCTTAACTTCAAGGATATCAATCTTTTCAATCAAGCCCTTCTAGCCAAGCAAGCTTGGAACTTATTAACTAAGACTTAA CCATTTCTGGTGGGGTTCTTCGAATTCTAAGAAGAAAAGTCACTGGTTAAGCTGGGATAAGTTGTGCTTGCTTAAAGTATTTGGTGGCCTTAACTTCAAGGATATCAATCTTTTCAATCAAGCCCTTCTAGCCAAGCAAGCTTGGAACTTATTAACTAAGACTTAA HFWWGSSNSKKKSHWLSWDKLCLLKVFGGLNFKDINLFNQALLAKQAWNLLTKT
BLAST of Bhi07G000890 vs. Swiss-Prot
Match: sp|P93295|M310_ARATH (Uncharacterized mitochondrial protein AtMg00310 OS=Arabidopsis thaliana OX=3702 GN=AtMg00310 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 8.9e-09 Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 0
BLAST of Bhi07G000890 vs. Swiss-Prot
Match: sp|P0C2F6|RNHX1_ARATH (Putative ribonuclease H protein At1g65750 OS=Arabidopsis thaliana OX=3702 GN=At1g65750 PE=3 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.2e-05 Identity = 22/50 (44.00%), Postives = 29/50 (58.00%), Query Frame = 0
BLAST of Bhi07G000890 vs. TAIR10
Match: AT4G29090.1 (Ribonuclease H-like superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 1.7e-10 Identity = 25/52 (48.08%), Postives = 31/52 (59.62%), Query Frame = 0
BLAST of Bhi07G000890 vs. TAIR10
Match: ATMG00310.1 (RNA-directed DNA polymerase (reverse transcriptase)-related family protein) HSP 1 Score: 60.1 bits (144), Expect = 4.9e-10 Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 0
BLAST of Bhi07G000890 vs. TrEMBL
Match: tr|Q9SK98|Q9SK98_ARATH (Very similar to retrotransposon reverse transcriptase OS=Arabidopsis thaliana OX=3702 GN=F12K8.9 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 7.5e-13 Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = 0
BLAST of Bhi07G000890 vs. TrEMBL
Match: tr|A0A0J8B9Y6|A0A0J8B9Y6_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris OX=3555 GN=BVRB_4g095640 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.8e-13 Identity = 31/53 (58.49%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Bhi07G000890 vs. TrEMBL
Match: tr|Q84MQ3|Q84MQ3_ORYSJ (Putative reverse transcriptase OS=Oryza sativa subsp. japonica OX=39947 GN=OSJNBa0030J19.11 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.9e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi07G000890 vs. TrEMBL
Match: tr|A2XHV0|A2XHV0_ORYSI (Uncharacterized protein OS=Oryza sativa subsp. indica OX=39946 GN=OsI_11988 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.9e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi07G000890 vs. TrEMBL
Match: tr|M8B835|M8B835_AEGTA (ABC transporter C family member 10 OS=Aegilops tauschii OX=37682 GN=F775_17562 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.9e-12 Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Bhi07G000890 vs. NCBI nr
Match: XP_009126341.1 (PREDICTED: uncharacterized protein LOC103851249 [Brassica rapa]) HSP 1 Score: 85.5 bits (210), Expect = 6.0e-14 Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Bhi07G000890 vs. NCBI nr
Match: XP_009150816.1 (PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]) HSP 1 Score: 85.5 bits (210), Expect = 6.0e-14 Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Bhi07G000890 vs. NCBI nr
Match: XP_013738713.1 (uncharacterized protein LOC106441439 [Brassica napus]) HSP 1 Score: 85.5 bits (210), Expect = 6.0e-14 Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Bhi07G000890 vs. NCBI nr
Match: XP_013646207.1 (uncharacterized protein LOC106350924 [Brassica napus]) HSP 1 Score: 85.5 bits (210), Expect = 6.0e-14 Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Bhi07G000890 vs. NCBI nr
Match: XP_013673759.1 (uncharacterized protein LOC106378122 [Brassica napus]) HSP 1 Score: 85.5 bits (210), Expect = 6.0e-14 Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|