Bhi07G000011 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGCTTTGGTTACATTCGGAGAAGGGTGGCGCAATATCCACCATGCATTCGAGTATTCGGCAAGACATGGTCATGAATGGTGGCAGATTGACTTCGGTTGGTACTTCATCATGTTTCTTCAAGCAATAGGATTGGCGACTGATGTTAAATTACCCCCAGCTTCAAAAGTAGCAGTAAAACTTTCATAA ATGGTAGCTTTGGTTACATTCGGAGAAGGGTGGCGCAATATCCACCATGCATTCGAGTATTCGGCAAGACATGGTCATGAATGGTGGCAGATTGACTTCGGTTGGTACTTCATCATGTTTCTTCAAGCAATAGGATTGGCGACTGATGTTAAATTACCCCCAGCTTCAAAAGTAGCAGTAAAACTTTCATAA ATGGTAGCTTTGGTTACATTCGGAGAAGGGTGGCGCAATATCCACCATGCATTCGAGTATTCGGCAAGACATGGTCATGAATGGTGGCAGATTGACTTCGGTTGGTACTTCATCATGTTTCTTCAAGCAATAGGATTGGCGACTGATGTTAAATTACCCCCAGCTTCAAAAGTAGCAGTAAAACTTTCATAA MVALVTFGEGWRNIHHAFEYSARHGHEWWQIDFGWYFIMFLQAIGLATDVKLPPASKVAVKLS
BLAST of Bhi07G000011 vs. Swiss-Prot
Match: sp|Q949X0|ADS3_ARATH (Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADS3 PE=1 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 2.5e-18 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Bhi07G000011 vs. Swiss-Prot
Match: sp|Q9LVZ3|ADS32_ARATH (Probable lipid desaturase ADS3.2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADS3.2 PE=2 SV=3) HSP 1 Score: 87.4 bits (215), Expect = 6.1e-17 Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Bhi07G000011 vs. Swiss-Prot
Match: sp|Q9FV68|ICO5D_LIMDO (Icosanoyl-CoA 5-desaturase (Fragment) OS=Limnanthes douglasii OX=28973 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-16 Identity = 39/52 (75.00%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi07G000011 vs. Swiss-Prot
Match: sp|P0DOW2|AL10_ANELE (Acyl-CoA C20 Delta5-desaturase OS=Anemone leveillei OX=212809 GN=AL10 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 0
BLAST of Bhi07G000011 vs. Swiss-Prot
Match: sp|P0DOW3|AL21_ANELE (Acyl-CoA 5-desaturase AL21 OS=Anemone leveillei OX=212809 GN=AL21 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 36/52 (69.23%), Postives = 42/52 (80.77%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR10
Match: AT3G15850.1 (fatty acid desaturase 5) HSP 1 Score: 92.0 bits (227), Expect = 1.4e-19 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR10
Match: AT3G15870.1 (Fatty acid desaturase family protein) HSP 1 Score: 87.4 bits (215), Expect = 3.4e-18 Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR10
Match: AT1G06080.1 (delta 9 desaturase 1) HSP 1 Score: 83.2 bits (204), Expect = 6.3e-17 Identity = 35/56 (62.50%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR10
Match: AT1G06100.1 (Fatty acid desaturase family protein) HSP 1 Score: 81.3 bits (199), Expect = 2.4e-16 Identity = 35/52 (67.31%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR10
Match: AT1G06090.1 (Fatty acid desaturase family protein) HSP 1 Score: 79.3 bits (194), Expect = 9.2e-16 Identity = 34/48 (70.83%), Postives = 37/48 (77.08%), Query Frame = 0
BLAST of Bhi07G000011 vs. TrEMBL
Match: tr|A0A0A0KAB1|A0A0A0KAB1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G376370 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.3e-20 Identity = 45/53 (84.91%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of Bhi07G000011 vs. TrEMBL
Match: tr|A0A1S3BS49|A0A1S3BS49_CUCME (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103492608 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 8.2e-19 Identity = 42/53 (79.25%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of Bhi07G000011 vs. TrEMBL
Match: tr|A0A1S3BQG5|A0A1S3BQG5_CUCME (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103492609 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 8.2e-19 Identity = 43/53 (81.13%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi07G000011 vs. TrEMBL
Match: tr|A0A0A0K8P8|A0A0A0K8P8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G377870 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.4e-18 Identity = 43/53 (81.13%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of Bhi07G000011 vs. TrEMBL
Match: tr|A0A251VDU0|A0A251VDU0_HELAN (Putative fatty acid desaturase, type 1, core OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr02g0033371 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.1e-18 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of Bhi07G000011 vs. NCBI nr
Match: XP_022155827.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Momordica charantia]) HSP 1 Score: 111.7 bits (278), Expect = 9.2e-22 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of Bhi07G000011 vs. NCBI nr
Match: XP_023549410.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 109.0 bits (271), Expect = 6.0e-21 Identity = 48/63 (76.19%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Bhi07G000011 vs. NCBI nr
Match: XP_022991768.1 (delta-9 acyl-lipid desaturase 2-like [Cucurbita maxima]) HSP 1 Score: 106.7 bits (265), Expect = 3.0e-20 Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Bhi07G000011 vs. NCBI nr
Match: XP_022953327.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 106.3 bits (264), Expect = 3.9e-20 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi07G000011 vs. NCBI nr
Match: XP_011659261.1 (PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Cucumis sativus] >KGN44746.1 hypothetical protein Csa_7G376370 [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 5.0e-20 Identity = 45/53 (84.91%), Postives = 48/53 (90.57%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|