Bhi07G000006 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGGTGGGTAAATATGAAGACAAAAGCATTGAGGTTTTTCTCAAAAACTACAAGCTTGGAAAAATTCTTGGAGTTGGCTCAACTGCAAAAGTTAAGGCTGCAAGGCATAAATTAACTGGACATCAAGTTGCCATCAAGATCCTCAACCATCGCAAAATTGCAAAAATGGGTCTCGAACAAAAAGGTTTCTCTTCTTCGTTATCTATTTATTTACCATTTGTCTGCCACGTAACGGTTTGA ATGGAGAAGGTGGGTAAATATGAAGACAAAAGCATTGAGGTTTTTCTCAAAAACTACAAGCTTGGAAAAATTCTTGGAGTTGGCTCAACTGCAAAAGTTAAGGCTGCAAGGCATAAATTAACTGGACATCAAGTTGCCATCAAGATCCTCAACCATCGCAAAATTGCAAAAATGGGTCTCGAACAAAAAGGTTTCTCTTCTTCGTTATCTATTTATTTACCATTTGTCTGCCACGTAACGGTTTGA ATGGAGAAGGTGGGTAAATATGAAGACAAAAGCATTGAGGTTTTTCTCAAAAACTACAAGCTTGGAAAAATTCTTGGAGTTGGCTCAACTGCAAAAGTTAAGGCTGCAAGGCATAAATTAACTGGACATCAAGTTGCCATCAAGATCCTCAACCATCGCAAAATTGCAAAAATGGGTCTCGAACAAAAAGGTTTCTCTTCTTCGTTATCTATTTATTTACCATTTGTCTGCCACGTAACGGTTTGA MEKVGKYEDKSIEVFLKNYKLGKILGVGSTAKVKAARHKLTGHQVAIKILNHRKIAKMGLEQKGFSSSLSIYLPFVCHVTV
BLAST of Bhi07G000006 vs. Swiss-Prot
Match: sp|P92958|KIN11_ARATH (SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.7e-11 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of Bhi07G000006 vs. Swiss-Prot
Match: sp|Q38997|KIN10_ARATH (SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 4.9e-11 Identity = 34/63 (53.97%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of Bhi07G000006 vs. Swiss-Prot
Match: sp|A2XFF4|OSK3_ORYSI (Serine/threonine protein kinase OSK3 OS=Oryza sativa subsp. indica OX=39946 GN=OSK3 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-10 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of Bhi07G000006 vs. Swiss-Prot
Match: sp|Q852Q0|OSK3_ORYSJ (Serine/threonine protein kinase OSK3 OS=Oryza sativa subsp. japonica OX=39947 GN=OSK3 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-10 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of Bhi07G000006 vs. Swiss-Prot
Match: sp|B8BBT7|OSK4_ORYSI (Serine/threonine protein kinase OSK4 OS=Oryza sativa subsp. indica OX=39946 GN=OSK4 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-10 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of Bhi07G000006 vs. TAIR10
Match: AT3G29160.1 (SNF1 kinase homolog 11) HSP 1 Score: 69.7 bits (169), Expect = 9.3e-13 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of Bhi07G000006 vs. TAIR10
Match: AT3G01090.2 (SNF1 kinase homolog 10) HSP 1 Score: 68.2 bits (165), Expect = 2.7e-12 Identity = 34/63 (53.97%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of Bhi07G000006 vs. TAIR10
Match: AT5G39440.1 (SNF1-related protein kinase 1.3) HSP 1 Score: 60.5 bits (145), Expect = 5.7e-10 Identity = 31/48 (64.58%), Postives = 35/48 (72.92%), Query Frame = 0
BLAST of Bhi07G000006 vs. TAIR10
Match: AT5G45820.1 (CBL-interacting protein kinase 20) HSP 1 Score: 51.2 bits (121), Expect = 3.4e-07 Identity = 25/52 (48.08%), Postives = 39/52 (75.00%), Query Frame = 0
BLAST of Bhi07G000006 vs. TAIR10
Match: AT5G01810.1 (CBL-interacting protein kinase 15) HSP 1 Score: 48.1 bits (113), Expect = 2.9e-06 Identity = 23/55 (41.82%), Postives = 36/55 (65.45%), Query Frame = 0
BLAST of Bhi07G000006 vs. TrEMBL
Match: tr|A0A1S3BUT7|A0A1S3BUT7_CUCME (Non-specific serine/threonine protein kinase OS=Cucumis melo OX=3656 GN=LOC103493434 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.2e-22 Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Bhi07G000006 vs. TrEMBL
Match: tr|A0A1S3BTQ3|A0A1S3BTQ3_CUCME (Non-specific serine/threonine protein kinase OS=Cucumis melo OX=3656 GN=LOC103493434 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.8e-22 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. TrEMBL
Match: tr|A0A1S3BTN0|A0A1S3BTN0_CUCME (SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X7 OS=Cucumis melo OX=3656 GN=LOC103493434 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.8e-22 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. TrEMBL
Match: tr|A0A1S3BUH4|A0A1S3BUH4_CUCME (SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X9 OS=Cucumis melo OX=3656 GN=LOC103493434 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.8e-22 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. TrEMBL
Match: tr|A0A1S3BTQ9|A0A1S3BTQ9_CUCME (SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X6 OS=Cucumis melo OX=3656 GN=LOC103493434 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.8e-22 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. NCBI nr
Match: XP_008452376.1 (PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X4 [Cucumis melo]) HSP 1 Score: 114.4 bits (285), Expect = 1.8e-22 Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Bhi07G000006 vs. NCBI nr
Match: XP_008452372.1 (PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X1 [Cucumis melo] >XP_008452373.1 PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X1 [Cucumis melo]) HSP 1 Score: 111.7 bits (278), Expect = 1.2e-21 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. NCBI nr
Match: XP_008452374.1 (PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X2 [Cucumis melo]) HSP 1 Score: 111.7 bits (278), Expect = 1.2e-21 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. NCBI nr
Match: XP_008452375.1 (PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X3 [Cucumis melo]) HSP 1 Score: 111.7 bits (278), Expect = 1.2e-21 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Bhi07G000006 vs. NCBI nr
Match: XP_008452378.1 (PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like isoform X6 [Cucumis melo]) HSP 1 Score: 111.7 bits (278), Expect = 1.2e-21 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|