Bhi06G001537 (gene) Wax gourd
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GGCCCGGAGACTTCTTGGTTCATCATGCTATTGCTTTAGGTTTACATACGACTACATTGATCTTAGTAAAAGGTTCTTTAGATGCACGTGGTTCCAAATTAATGCCGGATAAAAAGGATTTTGGTTATAGCTTTCCTTGCGACGGTCCAAGACAAGGTGGTACTTGTGATATTTCGGCTTGGGACGCCTTTTATTTGGCAGTTTTCTGGATGTTAAATACCATTGGATAG GGCCCGGAGACTTCTTGGTTCATCATGCTATTGCTTTAGGTTTACATACGACTACATTGATCTTAGTAAAAGGTTCTTTAGATGCACGTGGTTCCAAATTAATGCCGGATAAAAAGGATTTTGGTTATAGCTTTCCTTGCGACGGTCCAAGACAAGGTGGTACTTGTGATATTTCGGCTTGGGACGCCTTTTATTTGGCAGTTTTCTGGATGTTAAATACCATTGGATAG GGCCCGGAGACTTCTTGGTTCATCATGCTATTGCTTTAGGTTTACATACGACTACATTGATCTTAGTAAAAGGTTCTTTAGATGCACGTGGTTCCAAATTAATGCCGGATAAAAAGGATTTTGGTTATAGCTTTCCTTGCGACGGTCCAAGACAAGGTGGTACTTGTGATATTTCGGCTTGGGACGCCTTTTATTTGGCAGTTTTCTGGATGTTAAATACCATTGGATAG PGDFLVHHAIALGLHTTTLILVKGSLDARGSKLMPDKKDFGYSFPCDGPRQGGTCDISAWDAFYLAVFWMLNTIG
BLAST of Bhi06G001537 vs. Swiss-Prot
Match: sp|Q3V535|PSAB_ACOCL (Photosystem I P700 chlorophyll a apoprotein A2 OS=Acorus calamus OX=4465 GN=psaB PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 5.1e-39 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. Swiss-Prot
Match: sp|A4QJB4|PSAB_AETCO (Photosystem I P700 chlorophyll a apoprotein A2 OS=Aethionema cordifolium OX=434059 GN=psaB PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 5.1e-39 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. Swiss-Prot
Match: sp|A4QJJ8|PSAB_AETGR (Photosystem I P700 chlorophyll a apoprotein A2 OS=Aethionema grandiflorum OX=72657 GN=psaB PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 5.1e-39 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. Swiss-Prot
Match: sp|A1EA07|PSAB_AGRST (Photosystem I P700 chlorophyll a apoprotein A2 OS=Agrostis stolonifera OX=63632 GN=psaB PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 5.1e-39 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. Swiss-Prot
Match: sp|Q33332|PSAB_ANTMA (Photosystem I P700 chlorophyll a apoprotein A2 OS=Antirrhinum majus OX=4151 GN=psaB PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 5.1e-39 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. TAIR10
Match: ATCG00340.1 (Photosystem I, PsaA/PsaB protein) HSP 1 Score: 161.0 bits (406), Expect = 2.9e-40 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. TAIR10
Match: ATCG00350.1 (Photosystem I, PsaA/PsaB protein) HSP 1 Score: 102.4 bits (254), Expect = 1.2e-22 Identity = 43/72 (59.72%), Postives = 53/72 (73.61%), Query Frame = 0
BLAST of Bhi06G001537 vs. TrEMBL
Match: tr|K4KLD8|K4KLD8_9ROSI (PsaB (Fragment) OS=Trigonia sp. CCD-2012 OX=1241930 GN=psaB PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.6e-37 Identity = 73/75 (97.33%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of Bhi06G001537 vs. TrEMBL
Match: tr|A0A072TGF7|A0A072TGF7_MEDTR (Photosystem I P700 chlorophyll A apoprotein (Fragment) OS=Medicago truncatula OX=3880 GN=25480592 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 2.1e-37 Identity = 72/75 (96.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of Bhi06G001537 vs. TrEMBL
Match: tr|G7IAB8|G7IAB8_MEDTR (Photosystem I P700 chlorophyll A apoprotein OS=Medicago truncatula OX=3880 GN=11416934 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 2.1e-37 Identity = 72/75 (96.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of Bhi06G001537 vs. TrEMBL
Match: tr|D3WB19|D3WB19_DILIN (Photosystem I P700 chlorophyll a apoprotein A2 OS=Dillenia indica OX=4378 GN=psaB PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 4.7e-37 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. TrEMBL
Match: tr|A0A2G2XC02|A0A2G2XC02_CAPBA (Photosystem I chlorophyll a apoprotein A2 OS=Capsicum baccatum OX=33114 GN=CQW23_03465 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 4.7e-37 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. NCBI nr
Match: AFU95102.1 (PsaB, partial (chloroplast) [Trigonia sp. CCD-2012]) HSP 1 Score: 163.7 bits (413), Expect = 2.4e-37 Identity = 73/75 (97.33%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of Bhi06G001537 vs. NCBI nr
Match: KEH16432.1 (photosystem I P700 chlorophyll A apoprotein, partial [Medicago truncatula]) HSP 1 Score: 163.3 bits (412), Expect = 3.2e-37 Identity = 72/75 (96.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of Bhi06G001537 vs. NCBI nr
Match: AES61499.1 (photosystem I P700 chlorophyll A apoprotein [Medicago truncatula]) HSP 1 Score: 163.3 bits (412), Expect = 3.2e-37 Identity = 72/75 (96.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of Bhi06G001537 vs. NCBI nr
Match: ADD30793.1 (photosystem I P700 apoprotein A2 (chloroplast) [Dillenia indica]) HSP 1 Score: 162.2 bits (409), Expect = 7.1e-37 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of Bhi06G001537 vs. NCBI nr
Match: PHT54979.1 (Photosystem I chlorophyll a apoprotein A2 [Capsicum baccatum]) HSP 1 Score: 162.2 bits (409), Expect = 7.1e-37 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |