Bhi06G000485 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCGAGAGTGGGAACTTAGTTTCCGTCTGGGTATGCGTCCTTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGTTGCTACTGCTGTTTTCTTGATCTACCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGCTGAGCACAACATCCTTATGCACTCATTCCACATGTTAGGTGTAGCTGGTGTATTCGGCGGCTCCCTATTCAGTGTTATGCATGGTTCCTTGGTACTGACGTGA ATGGGTCGAGAGTGGGAACTTAGTTTCCGTCTGGGTATGCGTCCTTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGTTGCTACTGCTGTTTTCTTGATCTACCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGCTGAGCACAACATCCTTATGCACTCATTCCACATGTTAGGTGTAGCTGGTGTATTCGGCGGCTCCCTATTCAGTGTTATGCATGGTTCCTTGGTACTGACGTGA ATGGGTCGAGAGTGGGAACTTAGTTTCCGTCTGGGTATGCGTCCTTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGTTGCTACTGCTGTTTTCTTGATCTACCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGCTGAGCACAACATCCTTATGCACTCATTCCACATGTTAGGTGTAGCTGGTGTATTCGGCGGCTCCCTATTCAGTGTTATGCATGGTTCCTTGGTACTGACGTGA MGREWELSFRLGMRPWIAVAYSAPVAVATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHSFHMLGVAGVFGGSLFSVMHGSLVLT
BLAST of Bhi06G000485 vs. Swiss-Prot
Match: sp|Q3V554|PSBA_ACOCL (Photosystem II protein D1 OS=Acorus calamus OX=4465 GN=psbA PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 9.4e-46 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. Swiss-Prot
Match: sp|A4QJ96|PSBA_AETCO (Photosystem II protein D1 OS=Aethionema cordifolium OX=434059 GN=psbA PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 9.4e-46 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. Swiss-Prot
Match: sp|A4QJI0|PSBA_AETGR (Photosystem II protein D1 OS=Aethionema grandiflorum OX=72657 GN=psbA PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 9.4e-46 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. Swiss-Prot
Match: sp|A1E9Y8|PSBA_AGRST (Photosystem II protein D1 OS=Agrostis stolonifera OX=63632 GN=psbA PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 9.4e-46 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. Swiss-Prot
Match: sp|P02956|PSBA_AMAHY (Photosystem II protein D1 OS=Amaranthus hybridus OX=3565 GN=psbA PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 9.4e-46 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. TAIR10
Match: ATCG00020.1 (photosystem II reaction center protein A) HSP 1 Score: 183.7 bits (465), Expect = 5.2e-47 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. TAIR10
Match: ATCG00270.1 (photosystem II reaction center protein D) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-17 Identity = 40/93 (43.01%), Postives = 62/93 (66.67%), Query Frame = 0
BLAST of Bhi06G000485 vs. TrEMBL
Match: tr|A0A287Q7T9|A0A287Q7T9_HORVV (Photosystem II protein D1 OS=Hordeum vulgare subsp. vulgare OX=112509 PE=3 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 6.5e-44 Identity = 91/93 (97.85%), Postives = 91/93 (97.85%), Query Frame = 0
BLAST of Bhi06G000485 vs. TrEMBL
Match: tr|I7HUV1|I7HUV1_9EUKA (Photosystem II protein D1 (Fragment) OS=uncultured marine eukaryote OX=203449 GN=psbA PE=2 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. TrEMBL
Match: tr|I7HUW3|I7HUW3_9EUKA (Photosystem II protein D1 (Fragment) OS=uncultured marine eukaryote OX=203449 GN=psbA PE=2 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. TrEMBL
Match: tr|D6BKL1|D6BKL1_9EUKA (Photosystem II protein D1 (Fragment) OS=uncultured eukaryote OX=100272 GN=psbA PE=2 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. TrEMBL
Match: tr|D6BL14|D6BL14_9EUKA (Photosystem II protein D1 (Fragment) OS=uncultured eukaryote OX=100272 GN=psbA PE=2 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. NCBI nr
Match: AAD34735.1 (photosystem Q (B) protein precursor, partial (chloroplast) [Poa annua]) HSP 1 Score: 183.7 bits (465), Expect = 2.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. NCBI nr
Match: AAN77550.1 (PsbA, partial (plastid) [uncultured prasinophyte]) HSP 1 Score: 183.7 bits (465), Expect = 2.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. NCBI nr
Match: AAK53381.1 (herbicide binding protein D1, partial (chloroplast) [Lolium perenne]) HSP 1 Score: 183.7 bits (465), Expect = 2.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. NCBI nr
Match: AAN77560.1 (PsbA, partial (plastid) [uncultured prasinophyte]) HSP 1 Score: 183.7 bits (465), Expect = 2.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Bhi06G000485 vs. NCBI nr
Match: AAK50366.1 (Q(B) polypeptide, partial (chloroplast) [Medicago sativa]) HSP 1 Score: 183.7 bits (465), Expect = 2.9e-43 Identity = 90/93 (96.77%), Postives = 90/93 (96.77%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |