Bhi06G000473 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GTACTGAAGACAGTTCGAAGTAAAGTTGTCATGGGATGCAAAGTCGTCTTCAGCAGGGTCTTTCCTATCAAATTTCAGGCTGACAACCATCATCTTTGGAAGATGGTAGAGCAGTTGGGAGGCACTTGCTCAATCGAAGTTGATCGATCTCTAACACACGTGGTCTCAACGGATGCTGGAACGGAGAAGTCGCATAGCGTTGGGTTTGAAAGACGAGACGTTTCTGGTCAATCCAGATGGTTTATCTCTTTACAGTAG GTACTGAAGACAGTTCGAAGTAAAGTTGTCATGGGATGCAAAGTCGTCTTCAGCAGGGTCTTTCCTATCAAATTTCAGGCTGACAACCATCATCTTTGGAAGATGGTAGAGCAGTTGGGAGGCACTTGCTCAATCGAAGTTGATCGATCTCTAACACACGTGGTCTCAACGGATGCTGGAACGGAGAAGTCGCATAGCGTTGGGTTTGAAAGACGAGACGTTTCTGGTCAATCCAGATGGTTTATCTCTTTACAGTAG GTACTGAAGACAGTTCGAAGTAAAGTTGTCATGGGATGCAAAGTCGTCTTCAGCAGGGTCTTTCCTATCAAATTTCAGGCTGACAACCATCATCTTTGGAAGATGGTAGAGCAGTTGGGAGGCACTTGCTCAATCGAAGTTGATCGATCTCTAACACACGTGGTCTCAACGGATGCTGGAACGGAGAAGTCGCATAGCGTTGGGTTTGAAAGACGAGACGTTTCTGGTCAATCCAGATGGTTTATCTCTTTACAGTAG VLKTVRSKVVMGCKVVFSRVFPIKFQADNHHLWKMVEQLGGTCSIEVDRSLTHVVSTDAGTEKSHSVGFERRDVSGQSRWFISLQ
BLAST of Bhi06G000473 vs. Swiss-Prot
Match: sp|Q00IB6|CPL4_ARATH (RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana OX=3702 GN=CPL4 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.8e-17 Identity = 40/74 (54.05%), Postives = 55/74 (74.32%), Query Frame = 0
BLAST of Bhi06G000473 vs. Swiss-Prot
Match: sp|Q8LL04|CPL3_ARATH (RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana OX=3702 GN=CPL3 PE=1 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 1.1e-08 Identity = 25/64 (39.06%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of Bhi06G000473 vs. TAIR10
Match: AT5G58003.1 (C-terminal domain phosphatase-like 4) HSP 1 Score: 88.2 bits (217), Expect = 2.7e-18 Identity = 40/74 (54.05%), Postives = 55/74 (74.32%), Query Frame = 0
BLAST of Bhi06G000473 vs. TAIR10
Match: AT2G33540.1 (C-terminal domain phosphatase-like 3) HSP 1 Score: 60.5 bits (145), Expect = 5.9e-10 Identity = 25/64 (39.06%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of Bhi06G000473 vs. TrEMBL
Match: tr|A0A1S3CAQ0|A0A1S3CAQ0_CUCME (RNA polymerase II C-terminal domain phosphatase-like 4 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103498688 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.1e-23 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Bhi06G000473 vs. TrEMBL
Match: tr|A0A1S4E388|A0A1S4E388_CUCME (RNA polymerase II C-terminal domain phosphatase-like 4 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103498688 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.1e-23 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Bhi06G000473 vs. TrEMBL
Match: tr|A0A0A0KW61|A0A0A0KW61_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G650420 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 6.3e-22 Identity = 52/64 (81.25%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Bhi06G000473 vs. TrEMBL
Match: tr|M5VVV9|M5VVV9_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_7G261400 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 4.5e-20 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Bhi06G000473 vs. TrEMBL
Match: tr|A0A251NH63|A0A251NH63_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_7G261400 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 4.5e-20 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Bhi06G000473 vs. NCBI nr
Match: XP_022973448.1 (RNA polymerase II C-terminal domain phosphatase-like 4 [Cucurbita maxima]) HSP 1 Score: 119.0 bits (297), Expect = 7.8e-24 Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Bhi06G000473 vs. NCBI nr
Match: XP_008459611.1 (PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4 isoform X1 [Cucumis melo] >XP_008459612.1 PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4 isoform X1 [Cucumis melo] >XP_008459613.1 PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4 isoform X1 [Cucumis melo] >XP_016902439.1 PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4 isoform X1 [Cucumis melo]) HSP 1 Score: 117.9 bits (294), Expect = 1.7e-23 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Bhi06G000473 vs. NCBI nr
Match: XP_008459615.1 (PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4 isoform X2 [Cucumis melo] >XP_016902440.1 PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4 isoform X2 [Cucumis melo]) HSP 1 Score: 117.9 bits (294), Expect = 1.7e-23 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Bhi06G000473 vs. NCBI nr
Match: XP_023525838.1 (RNA polymerase II C-terminal domain phosphatase-like 4 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 117.9 bits (294), Expect = 1.7e-23 Identity = 55/64 (85.94%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Bhi06G000473 vs. NCBI nr
Match: XP_022949466.1 (RNA polymerase II C-terminal domain phosphatase-like 4 [Cucurbita moschata]) HSP 1 Score: 117.1 bits (292), Expect = 2.9e-23 Identity = 55/64 (85.94%), Postives = 59/64 (92.19%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |