Bhi06G000379 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACACGAAATGCACGACGCGGCGGAAAAATATGGGTACGTATATTTCCAGACAAACCCGTTACACTAAGACCCACAGAAACACGTATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAACCAGGTAGAATACTTTATGAAATGAATGGAGTAGCTGAAAATATAGCCAGAAAAACTATTTCAATAGCGGCATCCAAAATGCCTATACAAACCCAAATCATTACTTCAAGATAG ATGACACGAAATGCACGACGCGGCGGAAAAATATGGGTACGTATATTTCCAGACAAACCCGTTACACTAAGACCCACAGAAACACGTATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAACCAGGTAGAATACTTTATGAAATGAATGGAGTAGCTGAAAATATAGCCAGAAAAACTATTTCAATAGCGGCATCCAAAATGCCTATACAAACCCAAATCATTACTTCAAGATAG ATGACACGAAATGCACGACGCGGCGGAAAAATATGGGTACGTATATTTCCAGACAAACCCGTTACACTAAGACCCACAGAAACACGTATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAACCAGGTAGAATACTTTATGAAATGAATGGAGTAGCTGAAAATATAGCCAGAAAAACTATTTCAATAGCGGCATCCAAAATGCCTATACAAACCCAAATCATTACTTCAAGATAG MTRNARRGGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAVVKPGRILYEMNGVAENIARKTISIAASKMPIQTQIITSR
BLAST of Bhi06G000379 vs. Swiss-Prot
Match: sp|Q4VZN1|RK16_CUCSA (50S ribosomal protein L16, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl16 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 1.6e-38 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. Swiss-Prot
Match: sp|B1NWI7|RK16_MANES (50S ribosomal protein L16, chloroplastic OS=Manihot esculenta OX=3983 GN=rpl16 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.1e-37 Identity = 76/81 (93.83%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Bhi06G000379 vs. Swiss-Prot
Match: sp|Q09ME0|RK16_CITSI (50S ribosomal protein L16, chloroplastic OS=Citrus sinensis OX=2711 GN=rpl16 PE=3 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 2.4e-37 Identity = 75/81 (92.59%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Bhi06G000379 vs. Swiss-Prot
Match: sp|Q2L940|RK16_GOSHI (50S ribosomal protein L16, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rpl16 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.3e-37 Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Bhi06G000379 vs. Swiss-Prot
Match: sp|B1A972|RK16_CARPA (50S ribosomal protein L16, chloroplastic OS=Carica papaya OX=3649 GN=rpl16 PE=3 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 6.9e-37 Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Bhi06G000379 vs. TAIR10
Match: ATCG00790.1 (ribosomal protein L16) HSP 1 Score: 149.1 bits (375), Expect = 1.2e-36 Identity = 71/81 (87.65%), Postives = 74/81 (91.36%), Query Frame = 0
BLAST of Bhi06G000379 vs. TAIR10
Match: AT2G28830.1 (PLANT U-BOX 12) HSP 1 Score: 113.6 bits (283), Expect = 5.7e-26 Identity = 53/82 (64.63%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of Bhi06G000379 vs. TAIR10
Match: ATMG00080.1 (ribosomal protein L16) HSP 1 Score: 80.9 bits (198), Expect = 4.1e-16 Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 0
BLAST of Bhi06G000379 vs. TrEMBL
Match: tr|X2EZK1|X2EZK1_LAGSI (50S ribosomal protein L16, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rpl16 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.3e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. TrEMBL
Match: tr|A0A286NFT8|A0A286NFT8_CUCME (50S ribosomal protein L16, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=rpl16 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.3e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. TrEMBL
Match: tr|A0A249RY39|A0A249RY39_CUCME (50S ribosomal protein L16, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=rpl16 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.3e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. TrEMBL
Match: tr|A0A1P8LF95|A0A1P8LF95_CITLA (Ribosomal protein L16 OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=rpl16 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.3e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. TrEMBL
Match: tr|A0A218KG73|A0A218KG73_CUCSA (50S ribosomal protein L16, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rpl16 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.3e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. NCBI nr
Match: BAH95844.1 (ribosomal protein L16, partial (chloroplast) [Asparagus officinalis]) HSP 1 Score: 159.5 bits (402), Expect = 5.0e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. NCBI nr
Match: AHM88685.1 (ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM88744.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM88802.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM88860.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM88917.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM88975.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89034.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89093.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89152.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89211.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89270.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89330.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89389.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89448.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89507.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89567.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89626.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89685.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89744.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89803.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89862.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89921.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM89980.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90039.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90098.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90157.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90216.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90275.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90334.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90393.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90452.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90511.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90570.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90629.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90688.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90747.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90806.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90865.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90924.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM90983.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM91042.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM91100.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM91160.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM91218.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >AHM91275.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 159.5 bits (402), Expect = 5.0e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. NCBI nr
Match: ABI97454.1 (ribosomal protein L16, partial (chloroplast) [Cucumis sativus] >ABI98783.1 ribosomal protein L16, partial (chloroplast) [Cucumis sativus] >ARQ16116.1 ribosomal protein L16, partial (chloroplast) [Cucumis sativus] >ARQ16199.1 ribosomal protein L16, partial (chloroplast) [Cucumis sativus] >ARQ16282.1 ribosomal protein L16, partial (chloroplast) [Cucumis sativus] >ARQ16365.1 ribosomal protein L16, partial (chloroplast) [Cucumis sativus]) HSP 1 Score: 159.5 bits (402), Expect = 5.0e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. NCBI nr
Match: YP_009326027.1 (ribosomal protein L16 (chloroplast) [Citrullus lanatus] >YP_009348069.1 ribosomal protein L16 (plastid) [Citrullus mucosospermus] >YP_009420832.1 ribosomal protein L16 (chloroplast) [Citrullus colocynthis] >YP_009431680.1 ribosomal protein L16 (chloroplast) [Citrullus rehmii] >YP_009447488.1 ribosomal protein L16 (chloroplast) [Cucurbita maxima] >YP_009456183.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria] >APD52518.1 ribosomal protein L16 (chloroplast) [Citrullus lanatus] >APW82755.1 ribosomal protein L16 (plastid) [Citrullus mucosospermus] >APW82840.1 ribosomal protein L16 (plastid) [Citrullus mucosospermus] >APW82925.1 ribosomal protein L16 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83010.1 ribosomal protein L16 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83095.1 ribosomal protein L16 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83180.1 ribosomal protein L16 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83265.1 ribosomal protein L16 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83350.1 ribosomal protein L16 (plastid) [Citrullus mucosospermus] >ASP44499.1 ribosomal protein L16 (chloroplast) [Citrullus colocynthis] >ASY96285.1 ribosomal protein L16 (chloroplast) [Citrullus rehmii] >ATY69908.1 ribosomal protein L16 (chloroplast) [Cucurbita maxima] >AUJ21948.1 ribosomal protein L16 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 159.5 bits (402), Expect = 5.0e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Bhi06G000379 vs. NCBI nr
Match: ASY96370.1 (ribosomal protein L16 (chloroplast) [Cucumis melo subsp. agrestis] >ASY96457.1 ribosomal protein L16 (chloroplast) [Cucumis melo subsp. agrestis] >ASY96544.1 ribosomal protein L16 (chloroplast) [Cucumis melo subsp. agrestis] >ASY96630.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. conomon] >ASY96718.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. makuwa] >ASY96805.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. momordica] >ASY96892.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. dudaim] >ASY96979.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. cantalupo] >ASY97066.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. cantalupo] >ASY97153.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. inodorus] >ASY97240.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. cantalupo] >ASY97327.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. flexuosus] >ASY97414.1 ribosomal protein L16 (chloroplast) [Cucumis melo var. flexuosus] >ASY97502.1 ribosomal protein L16 (chloroplast) [Cucumis sativus var. hardwickii]) HSP 1 Score: 159.5 bits (402), Expect = 5.0e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |