Bhi06G000079 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAAATGTCCAGAAAGTTGTCGAACGCCTCAAATAGAGAAATCCTTCGAAATGTTGGCCTCGTCTTCACTGCTCGTAAGCCTTGGCTTGCGGTGGGAATGCGAAATGTTGACTACAAACGAGCATGCCACTTTGAGGTTGATCTATCGACTTTTTGA ATGAAGAAAATGTCCAGAAAGTTGTCGAACGCCTCAAATAGAGAAATCCTTCGAAATGTTGGCCTCGTCTTCACTGCTCGTAAGCCTTGGCTTGCGGTGGGAATGCGAAATGTTGACTACAAACGAGCATGCCACTTTGAGGTTGATCTATCGACTTTTTGA ATGAAGAAAATGTCCAGAAAGTTGTCGAACGCCTCAAATAGAGAAATCCTTCGAAATGTTGGCCTCGTCTTCACTGCTCGTAAGCCTTGGCTTGCGGTGGGAATGCGAAATGTTGACTACAAACGAGCATGCCACTTTGAGGTTGATCTATCGACTTTTTGA MKKMSRKLSNASNREILRNVGLVFTARKPWLAVGMRNVDYKRACHFEVDLSTF
BLAST of Bhi06G000079 vs. Swiss-Prot
Match: sp|P93472|DIM_PEA (Delta(24)-sterol reductase OS=Pisum sativum OX=3888 GN=DIM PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 6.0e-10 Identity = 34/55 (61.82%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of Bhi06G000079 vs. Swiss-Prot
Match: sp|Q39085|DIM_ARATH (Delta(24)-sterol reductase OS=Arabidopsis thaliana OX=3702 GN=DIM PE=1 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 7.9e-10 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of Bhi06G000079 vs. TAIR10
Match: AT3G19820.1 (cell elongation protein / DWARF1 / DIMINUTO (DIM)) HSP 1 Score: 63.5 bits (153), Expect = 4.4e-11 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of Bhi06G000079 vs. TrEMBL
Match: tr|A0A1S3CCJ1|A0A1S3CCJ1_CUCME (delta(24)-sterol reductase-like OS=Cucumis melo OX=3656 GN=LOC103499124 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.5e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000079 vs. TrEMBL
Match: tr|A0A0A0KZ82|A0A0A0KZ82_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G103350 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.5e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000079 vs. TrEMBL
Match: tr|A0A096QRL3|A0A096QRL3_MAIZE (Nana plant2 OS=Zea mays OX=4577 GN=ZEAMMB73_Zm00001d014887 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.2e-08 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of Bhi06G000079 vs. TrEMBL
Match: tr|A0A096QRL6|A0A096QRL6_MAIZE (Nana plant2 OS=Zea mays OX=4577 GN=ZEAMMB73_Zm00001d014887 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.2e-08 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of Bhi06G000079 vs. TrEMBL
Match: tr|A0A2U1PZ21|A0A2U1PZ21_ARTAN (FAD-binding, type 2 OS=Artemisia annua OX=35608 GN=CTI12_AA095800 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.2e-08 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of Bhi06G000079 vs. NCBI nr
Match: XP_004137177.1 (PREDICTED: delta(24)-sterol reductase-like [Cucumis sativus] >XP_011653373.1 PREDICTED: delta(24)-sterol reductase-like [Cucumis sativus] >KGN53687.1 hypothetical protein Csa_4G103350 [Cucumis sativus]) HSP 1 Score: 66.2 bits (160), Expect = 3.7e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000079 vs. NCBI nr
Match: XP_008460246.1 (PREDICTED: delta(24)-sterol reductase-like [Cucumis melo] >XP_008460247.1 PREDICTED: delta(24)-sterol reductase-like [Cucumis melo] >XP_008460248.1 PREDICTED: delta(24)-sterol reductase-like [Cucumis melo] >XP_008460249.1 PREDICTED: delta(24)-sterol reductase-like [Cucumis melo]) HSP 1 Score: 66.2 bits (160), Expect = 3.7e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000079 vs. NCBI nr
Match: XP_022948298.1 (delta(24)-sterol reductase-like [Cucurbita moschata] >XP_022948299.1 delta(24)-sterol reductase-like [Cucurbita moschata]) HSP 1 Score: 66.2 bits (160), Expect = 3.7e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000079 vs. NCBI nr
Match: XP_022998421.1 (delta(24)-sterol reductase-like [Cucurbita maxima] >XP_022998422.1 delta(24)-sterol reductase-like [Cucurbita maxima]) HSP 1 Score: 66.2 bits (160), Expect = 3.7e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000079 vs. NCBI nr
Match: XP_023523527.1 (delta(24)-sterol reductase-like [Cucurbita pepo subsp. pepo] >XP_023523528.1 delta(24)-sterol reductase-like [Cucurbita pepo subsp. pepo] >XP_023523529.1 delta(24)-sterol reductase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 66.2 bits (160), Expect = 3.7e-08 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|