Bhi05G001402 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGTGGAAAAGGTGAATACAGGAAGAACGGCGTTCATGACCAGAAGACATGGGACGGCAGTGTGGGAAATCGACACGGTGCCGGAGGCGGCAGTGATGTTTCAGATAAGGGTGATTTCGGGGTTCGATGGGATGTGGATCAATGCGGAGCGGGCGGTTCCGGCGGACTGGAAGCCAGGGATGATCTACGACCTTGGAGTTCAGATAGATACCATTGCCAAAGGACAAGAGAACTGCACAAAGTGTGATGAAGGGCATTGGTGA ATGTTGGTGGAAAAGGTGAATACAGGAAGAACGGCGTTCATGACCAGAAGACATGGGACGGCAGTGTGGGAAATCGACACGGTGCCGGAGGCGGCAGTGATGTTTCAGATAAGGGTGATTTCGGGGTTCGATGGGATGTGGATCAATGCGGAGCGGGCGGTTCCGGCGGACTGGAAGCCAGGGATGATCTACGACCTTGGAGTTCAGATAGATACCATTGCCAAAGGACAAGAGAACTGCACAAAGTGTGATGAAGGGCATTGGTGA ATGTTGGTGGAAAAGGTGAATACAGGAAGAACGGCGTTCATGACCAGAAGACATGGGACGGCAGTGTGGGAAATCGACACGGTGCCGGAGGCGGCAGTGATGTTTCAGATAAGGGTGATTTCGGGGTTCGATGGGATGTGGATCAATGCGGAGCGGGCGGTTCCGGCGGACTGGAAGCCAGGGATGATCTACGACCTTGGAGTTCAGATAGATACCATTGCCAAAGGACAAGAGAACTGCACAAAGTGTGATGAAGGGCATTGGTGA MLVEKVNTGRTAFMTRRHGTAVWEIDTVPEAAVMFQIRVISGFDGMWINAERAVPADWKPGMIYDLGVQIDTIAKGQENCTKCDEGHW
BLAST of Bhi05G001402 vs. Swiss-Prot
Match: sp|Q9SVE5|EXLA2_ARATH (Expansin-like A2 OS=Arabidopsis thaliana OX=3702 GN=EXLA2 PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 6.1e-15 Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Bhi05G001402 vs. Swiss-Prot
Match: sp|Q9LZT5|EXLA3_ARATH (Expansin-like A3 OS=Arabidopsis thaliana OX=3702 GN=EXLA3 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.6e-13 Identity = 37/85 (43.53%), Postives = 51/85 (60.00%), Query Frame = 0
BLAST of Bhi05G001402 vs. Swiss-Prot
Match: sp|Q8H274|EXLA3_ORYSJ (Expansin-like A3 OS=Oryza sativa subsp. japonica OX=39947 GN=EXLA3 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.7e-12 Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 0
BLAST of Bhi05G001402 vs. Swiss-Prot
Match: sp|Q10S70|EXLA1_ORYSJ (Expansin-like A1 OS=Oryza sativa subsp. japonica OX=39947 GN=EXLA1 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.8e-12 Identity = 35/87 (40.23%), Postives = 47/87 (54.02%), Query Frame = 0
BLAST of Bhi05G001402 vs. TAIR10
Match: AT4G38400.1 (expansin-like A2) HSP 1 Score: 81.3 bits (199), Expect = 3.4e-16 Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Bhi05G001402 vs. TAIR10
Match: AT3G45960.2 (expansin-like A3) HSP 1 Score: 75.9 bits (185), Expect = 1.4e-14 Identity = 37/85 (43.53%), Postives = 51/85 (60.00%), Query Frame = 0
BLAST of Bhi05G001402 vs. TrEMBL
Match: tr|A0A0A0K640|A0A0A0K640_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G018830 PE=4 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 1.3e-38 Identity = 75/88 (85.23%), Postives = 79/88 (89.77%), Query Frame = 0
BLAST of Bhi05G001402 vs. TrEMBL
Match: tr|A0A1S3BIH4|A0A1S3BIH4_CUCME (expansin-like A3 OS=Cucumis melo OX=3656 GN=LOC103490243 PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 1.2e-36 Identity = 70/83 (84.34%), Postives = 75/83 (90.36%), Query Frame = 0
BLAST of Bhi05G001402 vs. TrEMBL
Match: tr|B9HQZ5|B9HQZ5_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_007G083400v3 PE=3 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 7.4e-18 Identity = 46/88 (52.27%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of Bhi05G001402 vs. TrEMBL
Match: tr|A0A2K1Z7R5|A0A2K1Z7R5_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_009G141400v3 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 7.4e-18 Identity = 46/88 (52.27%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of Bhi05G001402 vs. TrEMBL
Match: tr|A9PAL4|A9PAL4_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_004G181700v3 PE=2 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.7e-17 Identity = 44/84 (52.38%), Postives = 54/84 (64.29%), Query Frame = 0
BLAST of Bhi05G001402 vs. NCBI nr
Match: KGN43301.1 (hypothetical protein Csa_7G018830 [Cucumis sativus]) HSP 1 Score: 167.5 bits (423), Expect = 2.0e-38 Identity = 75/88 (85.23%), Postives = 79/88 (89.77%), Query Frame = 0
BLAST of Bhi05G001402 vs. NCBI nr
Match: XP_011658619.1 (PREDICTED: expansin-like A3 [Cucumis sativus]) HSP 1 Score: 161.4 bits (407), Expect = 1.4e-36 Identity = 71/83 (85.54%), Postives = 75/83 (90.36%), Query Frame = 0
BLAST of Bhi05G001402 vs. NCBI nr
Match: XP_008447894.1 (PREDICTED: expansin-like A3 [Cucumis melo]) HSP 1 Score: 161.0 bits (406), Expect = 1.8e-36 Identity = 70/83 (84.34%), Postives = 75/83 (90.36%), Query Frame = 0
BLAST of Bhi05G001402 vs. NCBI nr
Match: XP_023529769.1 (expansin-like A2 isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 159.5 bits (402), Expect = 5.4e-36 Identity = 68/83 (81.93%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Bhi05G001402 vs. NCBI nr
Match: XP_022928449.1 (expansin-like A2 isoform X1 [Cucurbita moschata]) HSP 1 Score: 158.3 bits (399), Expect = 1.2e-35 Identity = 68/83 (81.93%), Postives = 75/83 (90.36%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |