Bhi05G001394 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAGAAGTTATGGAGCTGTTTGGAAAACAGACCATGTACCTGAAGGTACATTACAATTGAGAATGGTGGTGACTTCTAGATACAATGGAAAATGGGTTTGGGCAAAGTCTATACTTCCTGTCAATTGGAGAGCTGGAGCGATTTACGATACTGGAGTTCAAATCAAAGATATTGTCAAAAAAGAGTTGCCCTCTTGGCAATGTGGTGGTGCACAATGA ATGAAGAGAAGTTATGGAGCTGTTTGGAAAACAGACCATGTACCTGAAGGTACATTACAATTGAGAATGGTGGTGACTTCTAGATACAATGGAAAATGGGTTTGGGCAAAGTCTATACTTCCTGTCAATTGGAGAGCTGGAGCGATTTACGATACTGGAGTTCAAATCAAAGATATTGTCAAAAAAGAGTTGCCCTCTTGGCAATGTGGTGGTGCACAATGA ATGAAGAGAAGTTATGGAGCTGTTTGGAAAACAGACCATGTACCTGAAGGTACATTACAATTGAGAATGGTGGTGACTTCTAGATACAATGGAAAATGGGTTTGGGCAAAGTCTATACTTCCTGTCAATTGGAGAGCTGGAGCGATTTACGATACTGGAGTTCAAATCAAAGATATTGTCAAAAAAGAGTTGCCCTCTTGGCAATGTGGTGGTGCACAATGA MKRSYGAVWKTDHVPEGTLQLRMVVTSRYNGKWVWAKSILPVNWRAGAIYDTGVQIKDIVKKELPSWQCGGAQ
BLAST of Bhi05G001394 vs. Swiss-Prot
Match: sp|Q9LZT4|EXLA1_ARATH (Expansin-like A1 OS=Arabidopsis thaliana OX=3702 GN=EXLA1 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.2e-17 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of Bhi05G001394 vs. Swiss-Prot
Match: sp|Q9SVE5|EXLA2_ARATH (Expansin-like A2 OS=Arabidopsis thaliana OX=3702 GN=EXLA2 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.2e-17 Identity = 37/62 (59.68%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi05G001394 vs. Swiss-Prot
Match: sp|Q9LZT5|EXLA3_ARATH (Expansin-like A3 OS=Arabidopsis thaliana OX=3702 GN=EXLA3 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.2e-16 Identity = 36/62 (58.06%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Bhi05G001394 vs. Swiss-Prot
Match: sp|Q8H274|EXLA3_ORYSJ (Expansin-like A3 OS=Oryza sativa subsp. japonica OX=39947 GN=EXLA3 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 3.0e-15 Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of Bhi05G001394 vs. Swiss-Prot
Match: sp|Q10S70|EXLA1_ORYSJ (Expansin-like A1 OS=Oryza sativa subsp. japonica OX=39947 GN=EXLA1 PE=2 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.6e-15 Identity = 34/63 (53.97%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of Bhi05G001394 vs. TAIR10
Match: AT3G45970.1 (expansin-like A1) HSP 1 Score: 88.6 bits (218), Expect = 1.8e-18 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of Bhi05G001394 vs. TAIR10
Match: AT4G38400.1 (expansin-like A2) HSP 1 Score: 87.0 bits (214), Expect = 5.1e-18 Identity = 37/62 (59.68%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi05G001394 vs. TAIR10
Match: AT3G45960.2 (expansin-like A3) HSP 1 Score: 86.7 bits (213), Expect = 6.7e-18 Identity = 36/62 (58.06%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Bhi05G001394 vs. TrEMBL
Match: tr|A0A1S3BHW6|A0A1S3BHW6_CUCME (expansin-like A2 OS=Cucumis melo OX=3656 GN=LOC107990293 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 4.6e-29 Identity = 58/70 (82.86%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of Bhi05G001394 vs. TrEMBL
Match: tr|A0A1S3BJD7|A0A1S3BJD7_CUCME (expansin-like A2 OS=Cucumis melo OX=3656 GN=LOC103490240 PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 6.2e-26 Identity = 51/70 (72.86%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Bhi05G001394 vs. TrEMBL
Match: tr|A0A0A0K645|A0A0A0K645_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G019860 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 3.1e-25 Identity = 53/70 (75.71%), Postives = 58/70 (82.86%), Query Frame = 0
BLAST of Bhi05G001394 vs. TrEMBL
Match: tr|A0A1S3BIG0|A0A1S3BIG0_CUCME (expansin-like A1 OS=Cucumis melo OX=3656 GN=LOC103490238 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 4.1e-22 Identity = 49/72 (68.06%), Postives = 56/72 (77.78%), Query Frame = 0
BLAST of Bhi05G001394 vs. TrEMBL
Match: tr|A0A0A0K2Q2|A0A0A0K2Q2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G019840 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.7e-21 Identity = 47/72 (65.28%), Postives = 56/72 (77.78%), Query Frame = 0
BLAST of Bhi05G001394 vs. NCBI nr
Match: XP_008447887.1 (PREDICTED: expansin-like A2 [Cucumis melo]) HSP 1 Score: 135.6 bits (340), Expect = 6.9e-29 Identity = 58/70 (82.86%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of Bhi05G001394 vs. NCBI nr
Match: XP_022952636.1 (expansin-like A2 [Cucurbita moschata]) HSP 1 Score: 127.5 bits (319), Expect = 1.9e-26 Identity = 54/73 (73.97%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi05G001394 vs. NCBI nr
Match: XP_022969220.1 (expansin-like A2 [Cucurbita maxima]) HSP 1 Score: 127.5 bits (319), Expect = 1.9e-26 Identity = 54/73 (73.97%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi05G001394 vs. NCBI nr
Match: XP_023554598.1 (expansin-like A2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 127.5 bits (319), Expect = 1.9e-26 Identity = 54/73 (73.97%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi05G001394 vs. NCBI nr
Match: XP_022136197.1 (expansin-like A2 [Momordica charantia]) HSP 1 Score: 126.3 bits (316), Expect = 4.2e-26 Identity = 52/73 (71.23%), Postives = 62/73 (84.93%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |