Bhi05G001027 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTGGACGAAACCAAGAAATAACCCCTCACGTGCGAAATTATAGAAGATCTTCTTTAAGATCAAACAATTCCATTGAAACGGAGGAAATAAGGGAAAGCGAGGAAGAAACAGATGTAGAAATAGAAATCACTTCCGAAACGAAGGGGACTAAACAGGAACAAGAGGGATCCACCGAAGAAGATACTTCTCCTTCCCTTTTTTCGGAAGAAAATGAGGAAACAAAAGCAAAAATTCAGGACAAATGGGAACCGTTAACTTTAACTATTGACTGTGAATTCCTAAATGATTTTTGGATTGAAATTGAAAATTCGGTTTCTCTGTCGAAAGATGAGTAA ATGACTGGACGAAACCAAGAAATAACCCCTCACGTGCGAAATTATAGAAGATCTTCTTTAAGATCAAACAATTCCATTGAAACGGAGGAAATAAGGGAAAGCGAGGAAGAAACAGATGTAGAAATAGAAATCACTTCCGAAACGAAGGGGACTAAACAGGAACAAGAGGGATCCACCGAAGAAGATACTTCTCCTTCCCTTTTTTCGGAAGAAAATGAGGAAACAAAAGCAAAAATTCAGGACAAATGGGAACCGTTAACTTTAACTATTGACTGTGAATTCCTAAATGATTTTTGGATTGAAATTGAAAATTCGGTTTCTCTGTCGAAAGATGAGTAA ATGACTGGACGAAACCAAGAAATAACCCCTCACGTGCGAAATTATAGAAGATCTTCTTTAAGATCAAACAATTCCATTGAAACGGAGGAAATAAGGGAAAGCGAGGAAGAAACAGATGTAGAAATAGAAATCACTTCCGAAACGAAGGGGACTAAACAGGAACAAGAGGGATCCACCGAAGAAGATACTTCTCCTTCCCTTTTTTCGGAAGAAAATGAGGAAACAAAAGCAAAAATTCAGGACAAATGGGAACCGTTAACTTTAACTATTGACTGTGAATTCCTAAATGATTTTTGGATTGAAATTGAAAATTCGGTTTCTCTGTCGAAAGATGAGTAA MTGRNQEITPHVRNYRRSSLRSNNSIETEEIRESEEETDVEIEITSETKGTKQEQEGSTEEDTSPSLFSEENEETKAKIQDKWEPLTLTIDCEFLNDFWIEIENSVSLSKDE
BLAST of Bhi05G001027 vs. Swiss-Prot
Match: sp|Q67ID9|NU2C_SISMO (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Sisyrinchium montanum OX=207934 GN=ndhB PE=3 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 7.7e-07 Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 0
BLAST of Bhi05G001027 vs. Swiss-Prot
Match: sp|P0CC20|NU2C1_ACOAM (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Acorus americanus OX=263995 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 27/31 (87.10%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of Bhi05G001027 vs. Swiss-Prot
Match: sp|P0CC21|NU2C1_ACOCL (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Acorus calamus OX=4465 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 27/31 (87.10%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of Bhi05G001027 vs. Swiss-Prot
Match: sp|P0CC34|NU2C1_ATRBE (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Atropa belladonna OX=33113 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 27/31 (87.10%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of Bhi05G001027 vs. Swiss-Prot
Match: sp|P0CC36|NU2C1_BUXMI (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Buxus microphylla OX=153571 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 27/31 (87.10%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of Bhi05G001027 vs. TAIR10
Match: ATCG00890.1 (NADH-Ubiquinone/plastoquinone (complex I) protein) HSP 1 Score: 49.7 bits (117), Expect = 1.4e-06 Identity = 25/31 (80.65%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of Bhi05G001027 vs. TAIR10
Match: ATCG01250.1 (NADH-Ubiquinone/plastoquinone (complex I) protein) HSP 1 Score: 49.7 bits (117), Expect = 1.4e-06 Identity = 25/31 (80.65%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of Bhi05G001027 vs. TrEMBL
Match: tr|R4PIB2|R4PIB2_UTRGI (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Utricularia gibba OX=13748 GN=ndhB PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 7.0e-05 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi05G001027 vs. TrEMBL
Match: tr|A0A191VTD3|A0A191VTD3_9ROSI (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Kostermanthus robustus OX=692125 GN=ndhB PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 7.0e-05 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi05G001027 vs. TrEMBL
Match: tr|A0A2G3BUI7|A0A2G3BUI7_CAPCH (NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic OS=Capsicum chinense OX=80379 GN=BC332_21992 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 7.0e-05 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi05G001027 vs. TrEMBL
Match: tr|A0A0K1ZVI9|A0A0K1ZVI9_9ASTR (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Goodenia hassallii OX=1690104 GN=ndhB PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 7.0e-05 Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 0
BLAST of Bhi05G001027 vs. TrEMBL
Match: tr|J7F4F2|J7F4F2_ELOCA (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Elodea canadensis OX=100364 GN=ndhB PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 1.6e-04 Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 0
BLAST of Bhi05G001027 vs. NCBI nr
Match: YP_008082626.1 (NADH-plastoquinone oxidoreductase subunit 2 (chloroplast) [Utricularia gibba] >YP_008082643.1 NADH-plastoquinone oxidoreductase subunit 2 (chloroplast) [Utricularia gibba] >AGL61120.1 NADH-plastoquinone oxidoreductase subunit 2 (chloroplast) [Utricularia gibba] >AGL61138.1 NADH-plastoquinone oxidoreductase subunit 2 (chloroplast) [Utricularia gibba]) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-04 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi05G001027 vs. NCBI nr
Match: AKZ30309.1 (NADH dehydrogenase subunit 2 (chloroplast) [Goodenia hassallii]) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-04 Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 0
BLAST of Bhi05G001027 vs. NCBI nr
Match: YP_009264735.1 (NADH dehydrogenase subunit 2 (chloroplast) [Kostermanthus robustus] >YP_009264750.1 NADH dehydrogenase subunit 2 (chloroplast) [Kostermanthus robustus] >ANJ18985.1 NADH dehydrogenase subunit 2 (chloroplast) [Kostermanthus robustus] >ANJ18986.1 NADH dehydrogenase subunit 2 (chloroplast) [Kostermanthus robustus]) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-04 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi05G001027 vs. NCBI nr
Match: PHU10132.1 (NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic [Capsicum chinense]) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-04 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Bhi05G001027 vs. NCBI nr
Match: AAN31965.1 (NADH dehydrogenase subunit B, partial (chloroplast) [Scheuchzeria palustris]) HSP 1 Score: 54.7 bits (130), Expect = 2.4e-04 Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |