Bhi05G000415 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAGGTTGAAACCATCCTTGGCCAAGAAGCTTAACCCAAAGGGGTATAGCCCTATTCACTTGGCATTGCAAAATCATCAAATCGAGATCGTGTTACGACTCATCGATGTCGACCTAGATCTCATAAGCATACAAGGGAGGGAGGGCTTAAGTCCATTGCACGTTGCATCTTTTGGAGGAAAAGAGGAAGTGTTGGCTAAATTTTTTGGTTTTATGTCCAAAATCTATTAA ATGATGAGGTTGAAACCATCCTTGGCCAAGAAGCTTAACCCAAAGGGGTATAGCCCTATTCACTTGGCATTGCAAAATCATCAAATCGAGATCGTGTTACGACTCATCGATGTCGACCTAGATCTCATAAGCATACAAGGGAGGGAGGGCTTAAGTCCATTGCACGTTGCATCTTTTGGAGGAAAAGAGGAAGTGTTGGCTAAATTTTTTGGTTTTATGTCCAAAATCTATTAA ATGATGAGGTTGAAACCATCCTTGGCCAAGAAGCTTAACCCAAAGGGGTATAGCCCTATTCACTTGGCATTGCAAAATCATCAAATCGAGATCGTGTTACGACTCATCGATGTCGACCTAGATCTCATAAGCATACAAGGGAGGGAGGGCTTAAGTCCATTGCACGTTGCATCTTTTGGAGGAAAAGAGGAAGTGTTGGCTAAATTTTTTGGTTTTATGTCCAAAATCTATTAA MMRLKPSLAKKLNPKGYSPIHLALQNHQIEIVLRLIDVDLDLISIQGREGLSPLHVASFGGKEEVLAKFFGFMSKIY
BLAST of Bhi05G000415 vs. TAIR10
Match: AT4G11000.1 (Ankyrin repeat family protein) HSP 1 Score: 47.4 bits (111), Expect = 4.7e-06 Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = 0
BLAST of Bhi05G000415 vs. TrEMBL
Match: tr|W9S5M4|W9S5M4_9ROSA (Ankyrin repeat-containing protein OS=Morus notabilis OX=981085 GN=L484_023411 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 4.8e-13 Identity = 38/69 (55.07%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Bhi05G000415 vs. TrEMBL
Match: tr|G7LJ91|G7LJ91_MEDTR (Ankyrin repeat protein OS=Medicago truncatula OX=3880 GN=11441519 PE=4 SV=2) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-12 Identity = 37/69 (53.62%), Postives = 54/69 (78.26%), Query Frame = 0
BLAST of Bhi05G000415 vs. TrEMBL
Match: tr|W9SDK9|W9SDK9_9ROSA (Ankyrin repeat-containing protein OS=Morus notabilis OX=981085 GN=L484_023413 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-12 Identity = 37/67 (55.22%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Bhi05G000415 vs. TrEMBL
Match: tr|W9SG61|W9SG61_9ROSA (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Morus notabilis OX=981085 GN=L484_023414 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-12 Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Bhi05G000415 vs. TrEMBL
Match: tr|G7LIB8|G7LIB8_MEDTR (Ankyrin repeat protein OS=Medicago truncatula OX=3880 GN=25501097 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 3.1e-12 Identity = 37/69 (53.62%), Postives = 53/69 (76.81%), Query Frame = 0
BLAST of Bhi05G000415 vs. NCBI nr
Match: XP_023553682.1 (ankyrin repeat-containing protein BDA1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 111.7 bits (278), Expect = 1.1e-21 Identity = 52/69 (75.36%), Postives = 63/69 (91.30%), Query Frame = 0
BLAST of Bhi05G000415 vs. NCBI nr
Match: XP_022971840.1 (ankyrin repeat-containing protein BDA1-like [Cucurbita maxima]) HSP 1 Score: 110.2 bits (274), Expect = 3.3e-21 Identity = 50/69 (72.46%), Postives = 63/69 (91.30%), Query Frame = 0
BLAST of Bhi05G000415 vs. NCBI nr
Match: XP_022971942.1 (ankyrin repeat-containing protein BDA1-like [Cucurbita maxima]) HSP 1 Score: 109.8 bits (273), Expect = 4.3e-21 Identity = 52/69 (75.36%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Bhi05G000415 vs. NCBI nr
Match: XP_022971878.1 (ankyrin repeat-containing protein BDA1-like [Cucurbita maxima]) HSP 1 Score: 109.0 bits (271), Expect = 7.3e-21 Identity = 49/69 (71.01%), Postives = 63/69 (91.30%), Query Frame = 0
BLAST of Bhi05G000415 vs. NCBI nr
Match: XP_022971877.1 (ankyrin repeat-containing protein BDA1-like [Cucurbita maxima]) HSP 1 Score: 109.0 bits (271), Expect = 7.3e-21 Identity = 49/69 (71.01%), Postives = 63/69 (91.30%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|