Bhi05G000053 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAACAATGGAGGTTTTGGGGATTCCATGCTCTCCGATAATGGATCATTCATTACTACAGAAGATATTACCGATTGGGTTCAGGTTCATGCCCACTGATGAGATTCTTGTTCGACATTACCTTTTCAACAAGATTCATGGATTCCCATATTCTCAAGCCGTTGTTTTCGACTGCGATCTCTACGGCCTTATCGACCCTTGGGATATTTGGACTTCATACCAAGGCGTCGATGGTCAAGATCTTTTTTTCTTCTTGACCTAG ATGGCAACAATGGAGGTTTTGGGGATTCCATGCTCTCCGATAATGGATCATTCATTACTACAGAAGATATTACCGATTGGGTTCAGGTTCATGCCCACTGATGAGATTCTTGTTCGACATTACCTTTTCAACAAGATTCATGGATTCCCATATTCTCAAGCCGTTGTTTTCGACTGCGATCTCTACGGCCTTATCGACCCTTGGGATATTTGGACTTCATACCAAGGCGTCGATGGTCAAGATCTTTTTTTCTTCTTGACCTAG ATGGCAACAATGGAGGTTTTGGGGATTCCATGCTCTCCGATAATGGATCATTCATTACTACAGAAGATATTACCGATTGGGTTCAGGTTCATGCCCACTGATGAGATTCTTGTTCGACATTACCTTTTCAACAAGATTCATGGATTCCCATATTCTCAAGCCGTTGTTTTCGACTGCGATCTCTACGGCCTTATCGACCCTTGGGATATTTGGACTTCATACCAAGGCGTCGATGGTCAAGATCTTTTTTTCTTCTTGACCTAG MATMEVLGIPCSPIMDHSLLQKILPIGFRFMPTDEILVRHYLFNKIHGFPYSQAVVFDCDLYGLIDPWDIWTSYQGVDGQDLFFFLT
BLAST of Bhi05G000053 vs. Swiss-Prot
Match: sp|Q93VY3|NAC72_ARATH (NAC domain-containing protein 72 OS=Arabidopsis thaliana OX=3702 GN=NAC072 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.0e-06 Identity = 27/52 (51.92%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of Bhi05G000053 vs. Swiss-Prot
Match: sp|Q9ZNU2|NAC18_ARATH (NAC domain-containing protein 18 OS=Arabidopsis thaliana OX=3702 GN=NAC018 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.3e-06 Identity = 29/65 (44.62%), Postives = 36/65 (55.38%), Query Frame = 0
BLAST of Bhi05G000053 vs. Swiss-Prot
Match: sp|Q52QH4|NAC68_ORYSJ (NAC domain-containing protein 68 OS=Oryza sativa subsp. japonica OX=39947 GN=NAC068 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.9e-06 Identity = 28/64 (43.75%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of Bhi05G000053 vs. Swiss-Prot
Match: sp|Q84TD6|NAC47_ARATH (NAC transcription factor 47 OS=Arabidopsis thaliana OX=3702 GN=NAC047 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.7e-06 Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of Bhi05G000053 vs. Swiss-Prot
Match: sp|Q53NF7|NAC71_ORYSJ (NAC domain-containing protein 71 OS=Oryza sativa subsp. japonica OX=39947 GN=NAC071 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.7e-06 Identity = 26/61 (42.62%), Postives = 35/61 (57.38%), Query Frame = 0
BLAST of Bhi05G000053 vs. TAIR10
Match: AT4G27410.3 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein) HSP 1 Score: 53.9 bits (128), Expect = 5.7e-08 Identity = 27/52 (51.92%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of Bhi05G000053 vs. TAIR10
Match: AT1G52880.1 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-07 Identity = 29/65 (44.62%), Postives = 36/65 (55.38%), Query Frame = 0
BLAST of Bhi05G000053 vs. TAIR10
Match: AT3G04070.1 (NAC domain containing protein 47) HSP 1 Score: 51.2 bits (121), Expect = 3.7e-07 Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of Bhi05G000053 vs. TAIR10
Match: AT1G71930.1 (vascular related NAC-domain protein 7) HSP 1 Score: 50.8 bits (120), Expect = 4.8e-07 Identity = 26/71 (36.62%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of Bhi05G000053 vs. TAIR10
Match: AT1G33060.2 (NAC 014) HSP 1 Score: 50.4 bits (119), Expect = 6.3e-07 Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of Bhi05G000053 vs. TrEMBL
Match: tr|A0A1S3B979|A0A1S3B979_CUCME (NAC transcription factor 56-like OS=Cucumis melo OX=3656 GN=LOC103487180 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 4.2e-13 Identity = 34/60 (56.67%), Postives = 48/60 (80.00%), Query Frame = 0
BLAST of Bhi05G000053 vs. TrEMBL
Match: tr|A0A1S3CPA2|A0A1S3CPA2_CUCME (NAC domain-containing protein 83-like OS=Cucumis melo OX=3656 GN=LOC103503286 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 9.3e-13 Identity = 33/60 (55.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Bhi05G000053 vs. TrEMBL
Match: tr|A0A0A0M0I5|A0A0A0M0I5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G652300 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 9.3e-13 Identity = 34/60 (56.67%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of Bhi05G000053 vs. TrEMBL
Match: tr|A0A0A0LFJ5|A0A0A0LFJ5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G838730 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.2e-12 Identity = 34/60 (56.67%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of Bhi05G000053 vs. TrEMBL
Match: tr|A0A0A0KXM1|A0A0A0KXM1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G296900 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.2e-12 Identity = 34/60 (56.67%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of Bhi05G000053 vs. NCBI nr
Match: XP_023511534.1 (NAC domain-containing protein 72-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 84.0 bits (206), Expect = 2.8e-13 Identity = 35/65 (53.85%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of Bhi05G000053 vs. NCBI nr
Match: XP_022963781.1 (NAC domain-containing protein 30-like [Cucurbita moschata]) HSP 1 Score: 83.6 bits (205), Expect = 3.7e-13 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Bhi05G000053 vs. NCBI nr
Match: XP_008443625.1 (PREDICTED: NAC transcription factor 56-like [Cucumis melo]) HSP 1 Score: 82.8 bits (203), Expect = 6.3e-13 Identity = 34/60 (56.67%), Postives = 48/60 (80.00%), Query Frame = 0
BLAST of Bhi05G000053 vs. NCBI nr
Match: XP_023511535.1 (NAC transcription factor 25-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 82.4 bits (202), Expect = 8.2e-13 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Bhi05G000053 vs. NCBI nr
Match: XP_004139160.1 (PREDICTED: NAC domain-containing protein 66-like [Cucumis sativus]) HSP 1 Score: 81.6 bits (200), Expect = 1.4e-12 Identity = 34/60 (56.67%), Postives = 46/60 (76.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |