Bhi04G001699 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGAACCTCGACTCTATGGCCGGGGTTGTAGGAGACCATACGAAGTCGTGCCCTCGGGGACATTGGCGTCCGGCCGAGGACGAGAAGCTCCAACGATTAGTTCAGCAACACGGCGCGCAAAACTGGAATTTCATTGCAGATAAACTACAAGGAAGATCAGGCATGTCTCTTTTTTGTAATAATGTTTGA ATGCCGAACCTCGACTCTATGGCCGGGGTTGTAGGAGACCATACGAAGTCGTGCCCTCGGGGACATTGGCGTCCGGCCGAGGACGAGAAGCTCCAACGATTAGTTCAGCAACACGGCGCGCAAAACTGGAATTTCATTGCAGATAAACTACAAGGAAGATCAGGCATGTCTCTTTTTTGTAATAATGTTTGA ATGCCGAACCTCGACTCTATGGCCGGGGTTGTAGGAGACCATACGAAGTCGTGCCCTCGGGGACATTGGCGTCCGGCCGAGGACGAGAAGCTCCAACGATTAGTTCAGCAACACGGCGCGCAAAACTGGAATTTCATTGCAGATAAACTACAAGGAAGATCAGGCATGTCTCTTTTTTGTAATAATGTTTGA MPNLDSMAGVVGDHTKSCPRGHWRPAEDEKLQRLVQQHGAQNWNFIADKLQGRSGMSLFCNNV
BLAST of Bhi04G001699 vs. Swiss-Prot
Match: sp|Q5NBM8|CSA_ORYSJ (Transcription factor CSA OS=Oryza sativa subsp. japonica OX=39947 GN=CSA PE=2 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 3.8e-11 Identity = 30/42 (71.43%), Postives = 33/42 (78.57%), Query Frame = 0
BLAST of Bhi04G001699 vs. Swiss-Prot
Match: sp|Q6R053|MYB56_ARATH (Transcription factor MYB56 OS=Arabidopsis thaliana OX=3702 GN=MYB56 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 3.8e-11 Identity = 31/51 (60.78%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of Bhi04G001699 vs. Swiss-Prot
Match: sp|Q6R0C4|MYB52_ARATH (Transcription factor MYB52 OS=Arabidopsis thaliana OX=3702 GN=MYB52 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-10 Identity = 29/40 (72.50%), Postives = 31/40 (77.50%), Query Frame = 0
BLAST of Bhi04G001699 vs. Swiss-Prot
Match: sp|Q9FX36|MYB54_ARATH (Transcription factor MYB54 OS=Arabidopsis thaliana OX=3702 GN=MYB54 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.2e-10 Identity = 29/40 (72.50%), Postives = 32/40 (80.00%), Query Frame = 0
BLAST of Bhi04G001699 vs. Swiss-Prot
Match: sp|Q9SEZ4|MY105_ARATH (Transcription factor MYB105 OS=Arabidopsis thaliana OX=3702 GN=MYB105 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 4.2e-10 Identity = 29/41 (70.73%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of Bhi04G001699 vs. TAIR10
Match: AT5G17800.1 (myb domain protein 56) HSP 1 Score: 68.2 bits (165), Expect = 2.1e-12 Identity = 31/51 (60.78%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of Bhi04G001699 vs. TAIR10
Match: AT1G17950.1 (myb domain protein 52) HSP 1 Score: 66.6 bits (161), Expect = 6.1e-12 Identity = 29/40 (72.50%), Postives = 31/40 (77.50%), Query Frame = 0
BLAST of Bhi04G001699 vs. TAIR10
Match: AT4G33450.1 (myb domain protein 69) HSP 1 Score: 65.9 bits (159), Expect = 1.0e-11 Identity = 27/41 (65.85%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of Bhi04G001699 vs. TAIR10
Match: AT1G73410.1 (myb domain protein 54) HSP 1 Score: 65.1 bits (157), Expect = 1.8e-11 Identity = 29/40 (72.50%), Postives = 32/40 (80.00%), Query Frame = 0
BLAST of Bhi04G001699 vs. TAIR10
Match: AT1G69560.1 (myb domain protein 105) HSP 1 Score: 64.7 bits (156), Expect = 2.3e-11 Identity = 29/41 (70.73%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of Bhi04G001699 vs. TrEMBL
Match: tr|A0A0A0LIG5|A0A0A0LIG5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G229950 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 44/53 (83.02%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of Bhi04G001699 vs. TrEMBL
Match: tr|A0A1Q3DDL6|A0A1Q3DDL6_CEPFO (Myb_DNA-bind_6 domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_33934 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.2e-15 Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of Bhi04G001699 vs. TrEMBL
Match: tr|K7KUM6|K7KUM6_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100802283 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.0e-14 Identity = 36/46 (78.26%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of Bhi04G001699 vs. TrEMBL
Match: tr|V4TD41|V4TD41_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10001803mg PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.0e-14 Identity = 41/57 (71.93%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of Bhi04G001699 vs. TrEMBL
Match: tr|A0A2H5PI50|A0A2H5PI50_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_138790 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.0e-14 Identity = 41/57 (71.93%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of Bhi04G001699 vs. NCBI nr
Match: KGN61710.1 (hypothetical protein Csa_2G229950 [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 4.3e-19 Identity = 44/53 (83.02%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of Bhi04G001699 vs. NCBI nr
Match: XP_022975017.1 (transcription factor CSA-like [Cucurbita maxima]) HSP 1 Score: 93.2 bits (230), Expect = 3.4e-16 Identity = 42/57 (73.68%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of Bhi04G001699 vs. NCBI nr
Match: XP_022936691.1 (transcription factor MYB117-like [Cucurbita moschata]) HSP 1 Score: 92.8 bits (229), Expect = 4.4e-16 Identity = 42/57 (73.68%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of Bhi04G001699 vs. NCBI nr
Match: XP_023535350.1 (transcription factor MYB105-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 89.7 bits (221), Expect = 3.7e-15 Identity = 41/57 (71.93%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of Bhi04G001699 vs. NCBI nr
Match: GAV90525.1 (Myb_DNA-bind_6 domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 89.4 bits (220), Expect = 4.9e-15 Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|