Bhi04G001650 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGCACCAAACAAACAGCCCGTAAATCGACCGGCGGCAAGGCTCCCCGGAAGCAATTGGCGACGAAGGCTGCTCGGAAGTCGGCTCCGGCGACCGGAGGAGTAAAGAAGCCGCACAGATTTAGGCCGGGGACGGTGGCGCTGAGGGAGATTAGAAAGTACCAGAAGAGCACAGAGCTTCTGATCCGAAAGCTTCCGTTCCAGCGGCTAGTTAGAGAGATCGCTCAGGATTTCAAGACGGATCTTCGNATAACTCAAACTATTAGGGGGTACAATTTGAAAATTTCCCCATTTCCTATTTCAAAAGGAAAAAAGAAAATTGAAAAAAATACTTTGGCGCCAAAACTAATGTCTTAG ATGGCTCGCACCAAACAAACAGCCCGTAAATCGACCGGCGGCAAGGCTCCCCGGAAGCAATTGGCGACGAAGGCTGCTCGGAAGTCGGCTCCGGCGACCGGAGGAGTAAAGAAGCCGCACAGATTTAGGCCGGGGACGGTGGCGCTGAGGGAGATTAGAAAGTACCAGAAGAGCACAGAGCTTCTGATCCGAAAGCTTCCGTTCCAGCGGCTAGTTAGAGAGATCGCTCAGGATTTCAAGACGGATCTTCGNATAACTCAAACTATTAGGGGGTACAATTTGAAAATTTCCCCATTTCCTATTTCAAAAGGAAAAAAGAAAATTGAAAAAAATACTTTGGCGCCAAAACTAATGTCTTAG ATGGCTCGCACCAAACAAACAGCCCGTAAATCGACCGGCGGCAAGGCTCCCCGGAAGCAATTGGCGACGAAGGCTGCTCGGAAGTCGGCTCCGGCGACCGGAGGAGTAAAGAAGCCGCACAGATTTAGGCCGGGGACGGTGGCGCTGAGGGAGATTAGAAAGTACCAGAAGAGCACAGAGCTTCTGATCCGAAAGCTTCCGTTCCAGCGGCTAGTTAGAGAGATCGCTCAGGATTTCAAGACGGATCTTCGNATAACTCAAACTATTAGGGGGTACAATTTGAAAATTTCCCCATTTCCTATTTCAAAAGGAAAAAAGAAAATTGAAAAAAATACTTTGGCGCCAAAACTAATGTCTTAG MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRITQTIRGYNLKISPFPISKGKKKIEKNTLAPKLMS
BLAST of Bhi04G001650 vs. Swiss-Prot
Match: sp|P59226|H32_ARATH (Histone H3.2 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-37 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. Swiss-Prot
Match: sp|Q6LBE3|H32_ASPOF (Histone H3.2 OS=Asparagus officinalis OX=4686 PE=2 SV=3) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-37 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. Swiss-Prot
Match: sp|Q6LCK1|H32_BRANA (Histone H3.2 OS=Brassica napus OX=3708 PE=2 SV=3) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-37 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. Swiss-Prot
Match: sp|Q71T45|H32_EUPES (Histone H3.2 OS=Euphorbia esula OX=3993 GN=H3 PE=2 SV=3) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-37 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. Swiss-Prot
Match: sp|P69246|H32_MAIZE (Histone H3.2 OS=Zea mays OX=4577 GN=H3C2 PE=1 SV=2) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-37 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. TAIR10
Match: AT1G09200.1 (Histone superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 6.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. TAIR10
Match: AT3G27360.1 (Histone superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 6.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. TAIR10
Match: AT5G10390.1 (Histone superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 6.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. TAIR10
Match: AT5G10400.1 (Histone superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 6.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. TAIR10
Match: AT5G65360.1 (Histone superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 6.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Bhi04G001650 vs. TrEMBL
Match: tr|A0A2B4S651|A0A2B4S651_STYPI (Histone H3 OS=Stylophora pistillata OX=50429 GN=2 PE=3 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 1.4e-35 Identity = 89/124 (71.77%), Postives = 98/124 (79.03%), Query Frame = 0
BLAST of Bhi04G001650 vs. TrEMBL
Match: tr|A0A2K5F1S6|A0A2K5F1S6_AOTNA (Histone H3 OS=Aotus nancymaae OX=37293 PE=3 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 1.4e-35 Identity = 82/92 (89.13%), Postives = 88/92 (95.65%), Query Frame = 0
BLAST of Bhi04G001650 vs. TrEMBL
Match: tr|A9UZD4|A9UZD4_MONBE (Histone H3 OS=Monosiga brevicollis OX=81824 GN=21514 PE=3 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 1.8e-35 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of Bhi04G001650 vs. TrEMBL
Match: tr|A0A1B0CA22|A0A1B0CA22_LUTLO (Uncharacterized protein OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 2.4e-35 Identity = 89/121 (73.55%), Postives = 98/121 (80.99%), Query Frame = 0
BLAST of Bhi04G001650 vs. TrEMBL
Match: tr|A0A0D6LSG0|A0A0D6LSG0_9BILA (Histone H4 OS=Ancylostoma ceylanicum OX=53326 GN=ANCCEY_06747 PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 2.4e-35 Identity = 86/105 (81.90%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of Bhi04G001650 vs. NCBI nr
Match: AAA32655.1 (histone H3 (H3-1.1) [Medicago sativa]) HSP 1 Score: 158.3 bits (399), Expect = 1.6e-35 Identity = 84/89 (94.38%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of Bhi04G001650 vs. NCBI nr
Match: PFX24523.1 (histone H3 [Stylophora pistillata]) HSP 1 Score: 157.9 bits (398), Expect = 2.1e-35 Identity = 89/124 (71.77%), Postives = 98/124 (79.03%), Query Frame = 0
BLAST of Bhi04G001650 vs. NCBI nr
Match: XP_001745925.1 (hypothetical protein [Monosiga brevicollis MX1] >XP_001747171.1 hypothetical protein [Monosiga brevicollis MX1] >XP_001749159.1 hypothetical protein [Monosiga brevicollis MX1] >EDQ85965.1 predicted protein [Monosiga brevicollis MX1] >EDQ88095.1 predicted protein [Monosiga brevicollis MX1] >EDQ89349.1 predicted protein [Monosiga brevicollis MX1]) HSP 1 Score: 157.5 bits (397), Expect = 2.8e-35 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of Bhi04G001650 vs. NCBI nr
Match: AAA33907.1 (histone 3 [Oryza sativa] >AAA74190.1 histone H3 [Oryza sativa Indica Group]) HSP 1 Score: 157.5 bits (397), Expect = 2.8e-35 Identity = 86/91 (94.51%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of Bhi04G001650 vs. NCBI nr
Match: AAV65112.1 (histone 3 [Camellia sinensis]) HSP 1 Score: 157.1 bits (396), Expect = 3.6e-35 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |