Bhi04G001540 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTTCTGTTTTCTTTGTTGTGAGCCACAACTTGTTTGAAATAGGGGAGCCCCGATTGACATTGGATTATTATGCCAAAACTTGTCCCAATGTGTTGCAGGTTGTAAGGAAAGAAATGGAGTATGCTGTGCTTTCTGAACCATGCAATGCAGCTTTTGTTGTCCGATTGCACTTTCACGACTGCTTTATTCAG ATGCTTTCTGTTTTCTTTGTTGTGAGCCACAACTTGTTTGAAATAGGGGAGCCCCGATTGACATTGGATTATTATGCCAAAACTTGTCCCAATGTGTTGCAGGTTGTAAGGAAAGAAATGGAGTATGCTGTGCTTTCTGAACCATGCAATGCAGCTTTTGTTGTCCGATTGCACTTTCACGACTGCTTTATTCAG ATGCTTTCTGTTTTCTTTGTTGTGAGCCACAACTTGTTTGAAATAGGGGAGCCCCGATTGACATTGGATTATTATGCCAAAACTTGTCCCAATGTGTTGCAGGTTGTAAGGAAAGAAATGGAGTATGCTGTGCTTTCTGAACCATGCAATGCAGCTTTTGTTGTCCGATTGCACTTTCACGACTGCTTTATTCAG MLSVFFVVSHNLFEIGEPRLTLDYYAKTCPNVLQVVRKEMEYAVLSEPCNAAFVVRLHFHDCFIQ
BLAST of Bhi04G001540 vs. Swiss-Prot
Match: sp|Q96519|PER11_ARATH (Peroxidase 11 OS=Arabidopsis thaliana OX=3702 GN=PER11 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.1e-12 Identity = 37/73 (50.68%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of Bhi04G001540 vs. Swiss-Prot
Match: sp|Q39034|PER59_ARATH (Peroxidase 59 OS=Arabidopsis thaliana OX=3702 GN=PER59 PE=1 SV=2) HSP 1 Score: 57.8 bits (138), Expect = 5.3e-08 Identity = 24/46 (52.17%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of Bhi04G001540 vs. Swiss-Prot
Match: sp|Q42517|PERN_ARMRU (Peroxidase N OS=Armoracia rusticana OX=3704 GN=HRPN PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 6.9e-08 Identity = 24/46 (52.17%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of Bhi04G001540 vs. Swiss-Prot
Match: sp|P22195|PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea OX=3818 GN=PNC1 PE=1 SV=2) HSP 1 Score: 54.3 bits (129), Expect = 5.9e-07 Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 0
BLAST of Bhi04G001540 vs. Swiss-Prot
Match: sp|Q9LHA7|PER31_ARATH (Peroxidase 31 OS=Arabidopsis thaliana OX=3702 GN=PER31 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.0e-06 Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Bhi04G001540 vs. TAIR10
Match: AT1G68850.1 (Peroxidase superfamily protein) HSP 1 Score: 70.9 bits (172), Expect = 3.4e-13 Identity = 37/73 (50.68%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of Bhi04G001540 vs. TAIR10
Match: AT5G19890.1 (Peroxidase superfamily protein) HSP 1 Score: 57.8 bits (138), Expect = 2.9e-09 Identity = 24/46 (52.17%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of Bhi04G001540 vs. TAIR10
Match: AT3G28200.1 (Peroxidase superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 5.6e-08 Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Bhi04G001540 vs. TAIR10
Match: AT4G17690.1 (Peroxidase superfamily protein) HSP 1 Score: 53.1 bits (126), Expect = 7.3e-08 Identity = 25/65 (38.46%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Bhi04G001540 vs. TAIR10
Match: AT5G64110.1 (Peroxidase superfamily protein) HSP 1 Score: 53.1 bits (126), Expect = 7.3e-08 Identity = 26/67 (38.81%), Postives = 36/67 (53.73%), Query Frame = 0
BLAST of Bhi04G001540 vs. TrEMBL
Match: tr|A0A1S3BF69|A0A1S3BF69_CUCME (Peroxidase OS=Cucumis melo OX=3656 GN=LOC103489214 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.3e-21 Identity = 51/60 (85.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of Bhi04G001540 vs. TrEMBL
Match: tr|A0A2I4GG79|A0A2I4GG79_9ROSI (Peroxidase OS=Juglans regia OX=51240 GN=LOC109007603 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 7.4e-15 Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of Bhi04G001540 vs. TrEMBL
Match: tr|A0A2I4EGK9|A0A2I4EGK9_9ROSI (Peroxidase OS=Juglans regia OX=51240 GN=LOC108989409 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.3e-14 Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 0
BLAST of Bhi04G001540 vs. TrEMBL
Match: tr|M5XC68|M5XC68_PRUPE (Peroxidase OS=Prunus persica OX=3760 GN=PRUPE_ppa023689mg PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.3e-14 Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of Bhi04G001540 vs. TrEMBL
Match: tr|A0A251R592|A0A251R592_PRUPE (Peroxidase OS=Prunus persica OX=3760 GN=PRUPE_1G299000 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.3e-14 Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of Bhi04G001540 vs. NCBI nr
Match: XP_008446499.1 (PREDICTED: LOW QUALITY PROTEIN: peroxidase 11 [Cucumis melo]) HSP 1 Score: 108.6 bits (270), Expect = 8.0e-21 Identity = 51/60 (85.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of Bhi04G001540 vs. NCBI nr
Match: XP_004135419.1 (PREDICTED: peroxidase 11 [Cucumis sativus] >XP_011655736.1 PREDICTED: peroxidase 11 [Cucumis sativus]) HSP 1 Score: 108.2 bits (269), Expect = 1.0e-20 Identity = 53/68 (77.94%), Postives = 59/68 (86.76%), Query Frame = 0
BLAST of Bhi04G001540 vs. NCBI nr
Match: XP_022957298.1 (peroxidase 11-like isoform X1 [Cucurbita moschata] >XP_022957299.1 peroxidase 11-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 108.2 bits (269), Expect = 1.0e-20 Identity = 49/65 (75.38%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi04G001540 vs. NCBI nr
Match: XP_022986815.1 (peroxidase 11 isoform X1 [Cucurbita maxima] >XP_022986823.1 peroxidase 11 isoform X1 [Cucurbita maxima] >XP_022986832.1 peroxidase 11 isoform X1 [Cucurbita maxima]) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 49/65 (75.38%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi04G001540 vs. NCBI nr
Match: XP_023548451.1 (peroxidase 11-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 49/65 (75.38%), Postives = 57/65 (87.69%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |