Bhi04G001201 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGCACATGACCTTCTACTGGAGCAAGGAGGTGACTCTCCTCATCAATTCATGGCGGACAAATTCATGGTTGAGTTATTCCCTCTCTTTGCTTGCTTGTTTCATTGTCTCCATTTTCTACCAGTATTTGGAGAATTATCGAATCCGTTTGAAGCTTCTTCTGTGTCGGAAGCCATCGCCGTCAGAGATCGAGGCCCCTCTCCTTCGATCTAAAGTGGCTGGGAAGTTTCAGGCTGTGAGATTTGCTGCAGCTCTGTTTTACGGAGTCAACTCGGCGATCGGTTACCTTCTGATGCTCGCGATTATGTCCTTTAATGGCGGAGTTTTCGTTGCAATTGTCTTAGGGCTTGCGATCGGTTATTTGGTGTTTAGGAGTGACGATGAGGACGTTAGTGTTAGTGTTGAAAATCCTTGTGCATGTGCTTAG ATGATGCACATGACCTTCTACTGGAGCAAGGAGGTGACTCTCCTCATCAATTCATGGCGGACAAATTCATGGTTGAGTTATTCCCTCTCTTTGCTTGCTTGTTTCATTGTCTCCATTTTCTACCAGTATTTGGAGAATTATCGAATCCGTTTGAAGCTTCTTCTGTGTCGGAAGCCATCGCCGTCAGAGATCGAGGCCCCTCTCCTTCGATCTAAAGTGGCTGGGAAGTTTCAGGCTGTGAGATTTGCTGCAGCTCTGTTTTACGGAGTCAACTCGGCGATCGGTTACCTTCTGATGCTCGCGATTATGTCCTTTAATGGCGGAGTTTTCGTTGCAATTGTCTTAGGGCTTGCGATCGGTTATTTGGTGTTTAGGAGTGACGATGAGGACGTTAGTGTTAGTGTTGAAAATCCTTGTGCATGTGCTTAG ATGATGCACATGACCTTCTACTGGAGCAAGGAGGTGACTCTCCTCATCAATTCATGGCGGACAAATTCATGGTTGAGTTATTCCCTCTCTTTGCTTGCTTGTTTCATTGTCTCCATTTTCTACCAGTATTTGGAGAATTATCGAATCCGTTTGAAGCTTCTTCTGTGTCGGAAGCCATCGCCGTCAGAGATCGAGGCCCCTCTCCTTCGATCTAAAGTGGCTGGGAAGTTTCAGGCTGTGAGATTTGCTGCAGCTCTGTTTTACGGAGTCAACTCGGCGATCGGTTACCTTCTGATGCTCGCGATTATGTCCTTTAATGGCGGAGTTTTCGTTGCAATTGTCTTAGGGCTTGCGATCGGTTATTTGGTGTTTAGGAGTGACGATGAGGACGTTAGTGTTAGTGTTGAAAATCCTTGTGCATGTGCTTAG MMHMTFYWSKEVTLLINSWRTNSWLSYSLSLLACFIVSIFYQYLENYRIRLKLLLCRKPSPSEIEAPLLRSKVAGKFQAVRFAAALFYGVNSAIGYLLMLAIMSFNGGVFVAIVLGLAIGYLVFRSDDEDVSVSVENPCACA
BLAST of Bhi04G001201 vs. Swiss-Prot
Match: sp|Q69P80|COP51_ORYSJ (Copper transporter 5.1 OS=Oryza sativa subsp. japonica OX=39947 GN=COPT5.1 PE=2 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 2.4e-37 Identity = 88/150 (58.67%), Postives = 105/150 (70.00%), Query Frame = 0
BLAST of Bhi04G001201 vs. Swiss-Prot
Match: sp|Q93VM8|COPT5_ARATH (Copper transporter 5 OS=Arabidopsis thaliana OX=3702 GN=COPT5 PE=1 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 3.2e-34 Identity = 78/148 (52.70%), Postives = 99/148 (66.89%), Query Frame = 0
BLAST of Bhi04G001201 vs. Swiss-Prot
Match: sp|Q6Z0Q9|COP52_ORYSJ (Putative copper transporter 5.2 OS=Oryza sativa subsp. japonica OX=39947 GN=COPT5.2 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.9e-18 Identity = 63/176 (35.80%), Postives = 87/176 (49.43%), Query Frame = 0
BLAST of Bhi04G001201 vs. Swiss-Prot
Match: sp|Q9FGU8|COPT3_ARATH (Copper transporter 3 OS=Arabidopsis thaliana OX=3702 GN=COPT3 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 3.0e-11 Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 0
BLAST of Bhi04G001201 vs. Swiss-Prot
Match: sp|Q60EN8|COPT2_ORYSJ (Copper transporter 2 OS=Oryza sativa subsp. japonica OX=39947 GN=COPT2 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 2.1e-09 Identity = 45/125 (36.00%), Postives = 63/125 (50.40%), Query Frame = 0
BLAST of Bhi04G001201 vs. TAIR10
Match: AT5G20650.1 (copper transporter 5) HSP 1 Score: 146.0 bits (367), Expect = 1.8e-35 Identity = 78/148 (52.70%), Postives = 99/148 (66.89%), Query Frame = 0
BLAST of Bhi04G001201 vs. TAIR10
Match: AT5G59040.1 (copper transporter 3) HSP 1 Score: 69.7 bits (169), Expect = 1.6e-12 Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 0
BLAST of Bhi04G001201 vs. TAIR10
Match: AT2G26975.1 (Ctr copper transporter family) HSP 1 Score: 63.5 bits (153), Expect = 1.2e-10 Identity = 38/126 (30.16%), Postives = 64/126 (50.79%), Query Frame = 0
BLAST of Bhi04G001201 vs. TAIR10
Match: AT3G46900.1 (copper transporter 2) HSP 1 Score: 59.3 bits (142), Expect = 2.2e-09 Identity = 38/125 (30.40%), Postives = 64/125 (51.20%), Query Frame = 0
BLAST of Bhi04G001201 vs. TAIR10
Match: AT2G37925.1 (copper transporter 4) HSP 1 Score: 57.8 bits (138), Expect = 6.4e-09 Identity = 41/125 (32.80%), Postives = 64/125 (51.20%), Query Frame = 0
BLAST of Bhi04G001201 vs. TrEMBL
Match: tr|A0A1S3BCI1|A0A1S3BCI1_CUCME (copper transporter 5.1 OS=Cucumis melo OX=3656 GN=LOC103488528 PE=4 SV=1) HSP 1 Score: 260.8 bits (665), Expect = 1.8e-66 Identity = 134/142 (94.37%), Postives = 137/142 (96.48%), Query Frame = 0
BLAST of Bhi04G001201 vs. TrEMBL
Match: tr|A0A0A0KIJ7|A0A0A0KIJ7_CUCSA (Copper transporter OS=Cucumis sativus OX=3659 GN=Csa_6G361380 PE=4 SV=1) HSP 1 Score: 255.4 bits (651), Expect = 7.7e-65 Identity = 131/142 (92.25%), Postives = 134/142 (94.37%), Query Frame = 0
BLAST of Bhi04G001201 vs. TrEMBL
Match: tr|A0A2H5NBF1|A0A2H5NBF1_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_029670 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 5.7e-44 Identity = 90/143 (62.94%), Postives = 118/143 (82.52%), Query Frame = 0
BLAST of Bhi04G001201 vs. TrEMBL
Match: tr|A0A067G543|A0A067G543_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g043576mg PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 5.7e-44 Identity = 90/143 (62.94%), Postives = 118/143 (82.52%), Query Frame = 0
BLAST of Bhi04G001201 vs. TrEMBL
Match: tr|A0A200PT73|A0A200PT73_9MAGN (Ctr copper transporter OS=Macleaya cordata OX=56857 GN=BVC80_8107g3 PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 7.5e-44 Identity = 94/142 (66.20%), Postives = 113/142 (79.58%), Query Frame = 0
BLAST of Bhi04G001201 vs. NCBI nr
Match: XP_008445546.1 (PREDICTED: copper transporter 5.1 [Cucumis melo]) HSP 1 Score: 260.8 bits (665), Expect = 2.8e-66 Identity = 134/142 (94.37%), Postives = 137/142 (96.48%), Query Frame = 0
BLAST of Bhi04G001201 vs. NCBI nr
Match: XP_004144217.1 (PREDICTED: copper transporter 5.1 [Cucumis sativus] >KGN47576.1 Copper transporter [Cucumis sativus]) HSP 1 Score: 255.4 bits (651), Expect = 1.2e-64 Identity = 131/142 (92.25%), Postives = 134/142 (94.37%), Query Frame = 0
BLAST of Bhi04G001201 vs. NCBI nr
Match: XP_022999778.1 (copper transporter 5.1 [Cucurbita maxima]) HSP 1 Score: 247.7 bits (631), Expect = 2.4e-62 Identity = 125/142 (88.03%), Postives = 134/142 (94.37%), Query Frame = 0
BLAST of Bhi04G001201 vs. NCBI nr
Match: XP_023545540.1 (copper transporter 5.1-like [Cucurbita pepo subsp. pepo] >XP_023545549.1 copper transporter 5.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 245.0 bits (624), Expect = 1.6e-61 Identity = 123/142 (86.62%), Postives = 133/142 (93.66%), Query Frame = 0
BLAST of Bhi04G001201 vs. NCBI nr
Match: XP_022946913.1 (copper transporter 5.1 [Cucurbita moschata]) HSP 1 Score: 244.6 bits (623), Expect = 2.0e-61 Identity = 123/142 (86.62%), Postives = 132/142 (92.96%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|