Bhi04G000722 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGATCGATCAAAGCAGGTGACCACTTGGACGCTCTACCACACCACTCCTCCCTCTCGCCAGACCGTTAAATTCTTGACGGTGGCTACTATTCGTACCATCTTCCTCGTCTCTTCTGGCTTGACAATAACCGGAACAGTTCTAATGCTGATACTCTCCACTCCAATTCTCGTCCTGTTTAGTCATATTCTGGTACCAGCGGCAACTGTTTTGGTCTTGGCAGCTGCCGGATCTTTCTTCTCAGCAACTTGTCGTGGTTGTACAGATACATGA ATGTCCGATCGATCAAAGCAGGTGACCACTTGGACGCTCTACCACACCACTCCTCCCTCTCGCCAGACCGTTAAATTCTTGACGGTGGCTACTATTCGTACCATCTTCCTCGTCTCTTCTGGCTTGACAATAACCGGAACAGTTCTAATGCTGATACTCTCCACTCCAATTCTCGTCCTGTTTAGTCATATTCTGGTACCAGCGGCAACTGTTTTGGTCTTGGCAGCTGCCGGATCTTTCTTCTCAGCAACTTGTCGTGGTTGTACAGATACATGA ATGTCCGATCGATCAAAGCAGGTGACCACTTGGACGCTCTACCACACCACTCCTCCCTCTCGCCAGACCGTTAAATTCTTGACGGTGGCTACTATTCGTACCATCTTCCTCGTCTCTTCTGGCTTGACAATAACCGGAACAGTTCTAATGCTGATACTCTCCACTCCAATTCTCGTCCTGTTTAGTCATATTCTGGTACCAGCGGCAACTGTTTTGGTCTTGGCAGCTGCCGGATCTTTCTTCTCAGCAACTTGTCGTGGTTGTACAGATACATGA MSDRSKQVTTWTLYHTTPPSRQTVKFLTVATIRTIFLVSSGLTITGTVLMLILSTPILVLFSHILVPAATVLVLAAAGSFFSATCRGCTDT
BLAST of Bhi04G000722 vs. Swiss-Prot
Match: sp|P29527|OLEO6_GOSHI (Oleosin 18.2 kDa OS=Gossypium hirsutum OX=3635 GN=MATP6-A PE=2 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.3e-04 Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 0
BLAST of Bhi04G000722 vs. Swiss-Prot
Match: sp|P29528|OLEO7_GOSHI (Oleosin 16.4 kDa OS=Gossypium hirsutum OX=3635 GN=MATP7 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.7e-04 Identity = 37/97 (38.14%), Postives = 55/97 (56.70%), Query Frame = 0
BLAST of Bhi04G000722 vs. Swiss-Prot
Match: sp|Q43284|OLEO3_ARATH (Oleosin 14.9 kDa OS=Arabidopsis thaliana OX=3702 GN=OL3 PE=2 SV=2) HSP 1 Score: 45.8 bits (107), Expect = 2.9e-04 Identity = 29/61 (47.54%), Postives = 38/61 (62.30%), Query Frame = 0
BLAST of Bhi04G000722 vs. TAIR10
Match: AT2G25890.1 (Oleosin family protein) HSP 1 Score: 61.2 bits (147), Expect = 3.7e-10 Identity = 37/74 (50.00%), Postives = 52/74 (70.27%), Query Frame = 0
BLAST of Bhi04G000722 vs. TAIR10
Match: AT5G51210.1 (oleosin3) HSP 1 Score: 45.8 bits (107), Expect = 1.6e-05 Identity = 29/61 (47.54%), Postives = 38/61 (62.30%), Query Frame = 0
BLAST of Bhi04G000722 vs. TAIR10
Match: AT4G25140.1 (oleosin 1) HSP 1 Score: 40.0 bits (92), Expect = 8.9e-04 Identity = 28/59 (47.46%), Postives = 35/59 (59.32%), Query Frame = 0
BLAST of Bhi04G000722 vs. TrEMBL
Match: tr|A5BPD9|A5BPD9_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_04s0008g00540 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.7e-13 Identity = 53/85 (62.35%), Postives = 61/85 (71.76%), Query Frame = 0
BLAST of Bhi04G000722 vs. TrEMBL
Match: tr|C3VHQ8|C3VHQ8_SOYBN (Oleosin OS=Glycine max OX=3847 GN=100301903 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 44/68 (64.71%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of Bhi04G000722 vs. TrEMBL
Match: tr|K7KTR9|K7KTR9_SOYBN (Oleosin OS=Glycine max OX=3847 GN=GLYMA_06G078700 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 44/68 (64.71%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of Bhi04G000722 vs. TrEMBL
Match: tr|I1JUP4|I1JUP4_SOYBN (Oleosin OS=Glycine max OX=3847 GN=100301903 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 44/68 (64.71%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of Bhi04G000722 vs. TrEMBL
Match: tr|A0A0B2Q9B8|A0A0B2Q9B8_GLYSO (Oleosin OS=Glycine soja OX=3848 GN=glysoja_025116 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 44/68 (64.71%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of Bhi04G000722 vs. NCBI nr
Match: XP_002275496.1 (PREDICTED: oleosin 1 [Vitis vinifera] >CAN74835.1 hypothetical protein VITISV_023324 [Vitis vinifera]) HSP 1 Score: 82.4 bits (202), Expect = 8.6e-13 Identity = 53/85 (62.35%), Postives = 61/85 (71.76%), Query Frame = 0
BLAST of Bhi04G000722 vs. NCBI nr
Match: XP_010668835.1 (PREDICTED: oleosin 16 kDa [Beta vulgaris subsp. vulgaris] >KMT18103.1 hypothetical protein BVRB_2g032920 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 79.0 bits (193), Expect = 9.5e-12 Identity = 47/76 (61.84%), Postives = 58/76 (76.32%), Query Frame = 0
BLAST of Bhi04G000722 vs. NCBI nr
Match: XP_015885457.2 (oleosin 1 [Ziziphus jujuba]) HSP 1 Score: 78.6 bits (192), Expect = 1.2e-11 Identity = 50/85 (58.82%), Postives = 60/85 (70.59%), Query Frame = 0
BLAST of Bhi04G000722 vs. NCBI nr
Match: XP_008220136.1 (PREDICTED: oleosin 1-like [Prunus mume]) HSP 1 Score: 76.3 bits (186), Expect = 6.2e-11 Identity = 46/85 (54.12%), Postives = 60/85 (70.59%), Query Frame = 0
BLAST of Bhi04G000722 vs. NCBI nr
Match: NP_001236098.1 (oleosin family protein [Glycine max] >ACO90355.1 16.5 kDa oleosin [Glycine max] >ACU13135.1 unknown [Glycine max] >KRH61967.1 hypothetical protein GLYMA_04G077600 [Glycine max]) HSP 1 Score: 73.9 bits (180), Expect = 3.1e-10 Identity = 44/68 (64.71%), Postives = 53/68 (77.94%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |