Bhi04G000304 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.TTATTTGTAATTCTTGTGGTAACTTCATGTTTTACTGCAAGTCTTCCATCTATAATGACGGTTTCAAGATTTGCGCCATCAATTGTTGACATTGAAACATTAAAGCAAACAAACGAAACTTTGGGCTGCAACTATCATTCTTTCATCACGAGATATTTGAATTATACCTTGAAAATTCCTCGTGATAATATTAGGACCTTTGTTGGGATTGATGATTATCCAAAGACCTTTGACAATGGAGAAATTGAAGCAGCTTTCTTCATAGCTCCCTATGCTAAG TTATTTGTAATTCTTGTGGTAACTTCATGTTTTACTGCAAGTCTTCCATCTATAATGACGGTTTCAAGATTTGCGCCATCAATTGTTGACATTGAAACATTAAAGCAAACAAACGAAACTTTGGGCTGCAACTATCATTCTTTCATCACGAGATATTTGAATTATACCTTGAAAATTCCTCGTGATAATATTAGGACCTTTGTTGGGATTGATGATTATCCAAAGACCTTTGACAATGGAGAAATTGAAGCAGCTTTCTTCATAGCTCCCTATGCTAAG TTATTTGTAATTCTTGTGGTAACTTCATGTTTTACTGCAAGTCTTCCATCTATAATGACGGTTTCAAGATTTGCGCCATCAATTGTTGACATTGAAACATTAAAGCAAACAAACGAAACTTTGGGCTGCAACTATCATTCTTTCATCACGAGATATTTGAATTATACCTTGAAAATTCCTCGTGATAATATTAGGACCTTTGTTGGGATTGATGATTATCCAAAGACCTTTGACAATGGAGAAATTGAAGCAGCTTTCTTCATAGCTCCCTATGCTAAG LFVILVVTSCFTASLPSIMTVSRFAPSIVDIETLKQTNETLGCNYHSFITRYLNYTLKIPRDNIRTFVGIDDYPKTFDNGEIEAAFFIAPYAK
BLAST of Bhi04G000304 vs. Swiss-Prot
Match: sp|Q7XJL2|GLR31_ARATH (Glutamate receptor 3.1 OS=Arabidopsis thaliana OX=3702 GN=GLR3.1 PE=2 SV=3) HSP 1 Score: 50.8 bits (120), Expect = 9.3e-06 Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 0
BLAST of Bhi04G000304 vs. Swiss-Prot
Match: sp|Q84W41|GLR36_ARATH (Glutamate receptor 3.6 OS=Arabidopsis thaliana OX=3702 GN=GLR3.6 PE=2 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 4.6e-05 Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 0
BLAST of Bhi04G000304 vs. Swiss-Prot
Match: sp|Q93YT1|GLR32_ARATH (Glutamate receptor 3.2 OS=Arabidopsis thaliana OX=3702 GN=GLR3.2 PE=1 SV=2) HSP 1 Score: 47.8 bits (112), Expect = 7.9e-05 Identity = 29/91 (31.87%), Postives = 45/91 (49.45%), Query Frame = 0
BLAST of Bhi04G000304 vs. Swiss-Prot
Match: sp|Q9SHV1|GLR22_ARATH (Glutamate receptor 2.2 OS=Arabidopsis thaliana OX=3702 GN=GLR2.2 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-04 Identity = 33/96 (34.38%), Postives = 50/96 (52.08%), Query Frame = 0
BLAST of Bhi04G000304 vs. Swiss-Prot
Match: sp|Q9C8E7|GLR33_ARATH (Glutamate receptor 3.3 OS=Arabidopsis thaliana OX=3702 GN=GLR3.3 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-04 Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 0
BLAST of Bhi04G000304 vs. TAIR10
Match: AT2G17260.1 (glutamate receptor 2) HSP 1 Score: 50.8 bits (120), Expect = 5.2e-07 Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 0
BLAST of Bhi04G000304 vs. TAIR10
Match: AT3G51480.1 (glutamate receptor 3.6) HSP 1 Score: 48.5 bits (114), Expect = 2.6e-06 Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 0
BLAST of Bhi04G000304 vs. TAIR10
Match: AT4G35290.2 (glutamate receptor 2) HSP 1 Score: 47.8 bits (112), Expect = 4.4e-06 Identity = 29/91 (31.87%), Postives = 45/91 (49.45%), Query Frame = 0
BLAST of Bhi04G000304 vs. TAIR10
Match: AT1G42540.1 (glutamate receptor 3.3) HSP 1 Score: 47.4 bits (111), Expect = 5.7e-06 Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 0
BLAST of Bhi04G000304 vs. TAIR10
Match: AT2G24720.1 (glutamate receptor 2.2) HSP 1 Score: 47.4 bits (111), Expect = 5.7e-06 Identity = 33/96 (34.38%), Postives = 50/96 (52.08%), Query Frame = 0
BLAST of Bhi04G000304 vs. TrEMBL
Match: tr|A0A1S3BBI6|A0A1S3BBI6_CUCME (glutamate receptor 2.1-like OS=Cucumis melo OX=3656 GN=LOC103487897 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 1.2e-34 Identity = 75/93 (80.65%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Bhi04G000304 vs. TrEMBL
Match: tr|A0A1S3BAS6|A0A1S3BAS6_CUCME (glutamate receptor 2.1-like OS=Cucumis melo OX=3656 GN=LOC103487887 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 5.2e-30 Identity = 69/93 (74.19%), Postives = 80/93 (86.02%), Query Frame = 0
BLAST of Bhi04G000304 vs. TrEMBL
Match: tr|A0A2P5F8T4|A0A2P5F8T4_9ROSA (Glutamate receptor OS=Trema orientalis OX=63057 GN=TorRG33x02_099350 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 9.9e-21 Identity = 54/93 (58.06%), Postives = 69/93 (74.19%), Query Frame = 0
BLAST of Bhi04G000304 vs. TrEMBL
Match: tr|A0A2P6Q0I9|A0A2P6Q0I9_ROSCH (Glutamate receptor OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr6g0308011 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.3e-20 Identity = 54/93 (58.06%), Postives = 70/93 (75.27%), Query Frame = 0
BLAST of Bhi04G000304 vs. TrEMBL
Match: tr|A0A2P5CVJ9|A0A2P5CVJ9_PARAD (Glutamate receptor OS=Parasponia andersonii OX=3476 GN=PanWU01x14_119960 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.3e-20 Identity = 54/93 (58.06%), Postives = 68/93 (73.12%), Query Frame = 0
BLAST of Bhi04G000304 vs. NCBI nr
Match: XP_008444629.1 (PREDICTED: glutamate receptor 2.1-like [Cucumis melo]) HSP 1 Score: 154.5 bits (389), Expect = 1.8e-34 Identity = 75/93 (80.65%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Bhi04G000304 vs. NCBI nr
Match: XP_011650188.1 (PREDICTED: glutamate receptor 2.1-like [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 4.1e-34 Identity = 76/93 (81.72%), Postives = 83/93 (89.25%), Query Frame = 0
BLAST of Bhi04G000304 vs. NCBI nr
Match: XP_022962231.1 (glutamate receptor 2.5-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 142.9 bits (359), Expect = 5.5e-31 Identity = 71/93 (76.34%), Postives = 80/93 (86.02%), Query Frame = 0
BLAST of Bhi04G000304 vs. NCBI nr
Match: XP_022962232.1 (glutamate receptor 2.5-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 142.9 bits (359), Expect = 5.5e-31 Identity = 71/93 (76.34%), Postives = 80/93 (86.02%), Query Frame = 0
BLAST of Bhi04G000304 vs. NCBI nr
Match: XP_022962233.1 (glutamate receptor 2.5-like isoform X3 [Cucurbita moschata]) HSP 1 Score: 142.9 bits (359), Expect = 5.5e-31 Identity = 71/93 (76.34%), Postives = 80/93 (86.02%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |