Bhi04G000054 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTTACACCTCGGCAACTGATGGCATACAATGGCACCGACCGATCAAAGCCCATCTATGTGGCTTTGAAGGGCTGCATCTACGACGTCACAGCAGGCGCTTCCTTCTACGGTCCCGGTGGCCCCTACGCCATGTTCGCCGGGAAGGACGCGAGCAGAGCTCTGGCCAAGATGAGCAAGAACGAGGCGGACATCAGCTTTTCGCTTGAAGGACTCTCTGAGAAAGAAATGGGTGTTCTCAATGACTGGGAGAAGAAATTTCAAGCCAAGTACCCTATTGTTGGCCGTGTTGTTTAA ATGGAGCTTACACCTCGGCAACTGATGGCATACAATGGCACCGACCGATCAAAGCCCATCTATGTGGCTTTGAAGGGCTGCATCTACGACGTCACAGCAGGCGCTTCCTTCTACGGTCCCGGTGGCCCCTACGCCATGTTCGCCGGGAAGGACGCGAGCAGAGCTCTGGCCAAGATGAGCAAGAACGAGGCGGACATCAGCTTTTCGCTTGAAGGACTCTCTGAGAAAGAAATGGGTGTTCTCAATGACTGGGAGAAGAAATTTCAAGCCAAGTACCCTATTGTTGGCCGTGTTGTTTAA ATGGAGCTTACACCTCGGCAACTGATGGCATACAATGGCACCGACCGATCAAAGCCCATCTATGTGGCTTTGAAGGGCTGCATCTACGACGTCACAGCAGGCGCTTCCTTCTACGGTCCCGGTGGCCCCTACGCCATGTTCGCCGGGAAGGACGCGAGCAGAGCTCTGGCCAAGATGAGCAAGAACGAGGCGGACATCAGCTTTTCGCTTGAAGGACTCTCTGAGAAAGAAATGGGTGTTCTCAATGACTGGGAGAAGAAATTTCAAGCCAAGTACCCTATTGTTGGCCGTGTTGTTTAA MELTPRQLMAYNGTDRSKPIYVALKGCIYDVTAGASFYGPGGPYAMFAGKDASRALAKMSKNEADISFSLEGLSEKEMGVLNDWEKKFQAKYPIVGRVV
BLAST of Bhi04G000054 vs. Swiss-Prot
Match: sp|Q9SK39|SBP3_ARATH (Probable steroid-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=MP3 PE=1 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 8.3e-37 Identity = 73/99 (73.74%), Postives = 82/99 (82.83%), Query Frame = 0
BLAST of Bhi04G000054 vs. Swiss-Prot
Match: sp|Q9XFM6|MSBP1_ARATH (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSBP1 PE=1 SV=2) HSP 1 Score: 113.6 bits (283), Expect = 1.2e-24 Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of Bhi04G000054 vs. Swiss-Prot
Match: sp|Q9FVZ9|MSBP2_ORYSJ (Membrane steroid-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP2 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-24 Identity = 53/97 (54.64%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of Bhi04G000054 vs. Swiss-Prot
Match: sp|Q9M2Z4|MSBP2_ARATH (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSBP2 PE=1 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 3.6e-24 Identity = 52/97 (53.61%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of Bhi04G000054 vs. Swiss-Prot
Match: sp|Q9FVZ7|MSBP1_ORYSJ (Membrane steroid-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP1 PE=1 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-23 Identity = 53/97 (54.64%), Postives = 66/97 (68.04%), Query Frame = 0
BLAST of Bhi04G000054 vs. TAIR10
Match: AT2G24940.1 (membrane-associated progesterone binding protein 2) HSP 1 Score: 154.1 bits (388), Expect = 4.6e-38 Identity = 73/99 (73.74%), Postives = 82/99 (82.83%), Query Frame = 0
BLAST of Bhi04G000054 vs. TAIR10
Match: AT5G52240.1 (membrane steroid binding protein 1) HSP 1 Score: 113.6 bits (283), Expect = 6.9e-26 Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of Bhi04G000054 vs. TAIR10
Match: AT3G48890.1 (membrane-associated progesterone binding protein 3) HSP 1 Score: 112.1 bits (279), Expect = 2.0e-25 Identity = 52/97 (53.61%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of Bhi04G000054 vs. TAIR10
Match: AT4G14965.1 (membrane-associated progesterone binding protein 4) HSP 1 Score: 75.9 bits (185), Expect = 1.6e-14 Identity = 38/93 (40.86%), Postives = 54/93 (58.06%), Query Frame = 0
BLAST of Bhi04G000054 vs. TrEMBL
Match: tr|A0A1S3BD16|A0A1S3BD16_CUCME (probable steroid-binding protein 3 OS=Cucumis melo OX=3656 GN=LOC103488356 PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 2.2e-42 Identity = 87/99 (87.88%), Postives = 93/99 (93.94%), Query Frame = 0
BLAST of Bhi04G000054 vs. TrEMBL
Match: tr|A0A0A0LQG3|A0A0A0LQG3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G382750 PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 5.0e-39 Identity = 83/99 (83.84%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of Bhi04G000054 vs. TrEMBL
Match: tr|I1JU53|I1JU53_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100813061 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.1e-38 Identity = 80/99 (80.81%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of Bhi04G000054 vs. TrEMBL
Match: tr|A0A1S3U298|A0A1S3U298_VIGRR (probable steroid-binding protein 3 OS=Vigna radiata var. radiata OX=3916 GN=LOC106761144 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.1e-38 Identity = 80/99 (80.81%), Postives = 88/99 (88.89%), Query Frame = 0
BLAST of Bhi04G000054 vs. TrEMBL
Match: tr|A0A0L9UHB3|A0A0L9UHB3_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan04g227400 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.1e-38 Identity = 80/99 (80.81%), Postives = 88/99 (88.89%), Query Frame = 0
BLAST of Bhi04G000054 vs. NCBI nr
Match: XP_008445274.1 (PREDICTED: probable steroid-binding protein 3 [Cucumis melo]) HSP 1 Score: 180.3 bits (456), Expect = 3.3e-42 Identity = 87/99 (87.88%), Postives = 93/99 (93.94%), Query Frame = 0
BLAST of Bhi04G000054 vs. NCBI nr
Match: XP_022962142.1 (probable steroid-binding protein 3 [Cucurbita moschata]) HSP 1 Score: 175.3 bits (443), Expect = 1.1e-40 Identity = 85/99 (85.86%), Postives = 92/99 (92.93%), Query Frame = 0
BLAST of Bhi04G000054 vs. NCBI nr
Match: XP_022997574.1 (probable steroid-binding protein 3 [Cucurbita maxima]) HSP 1 Score: 174.9 bits (442), Expect = 1.4e-40 Identity = 85/99 (85.86%), Postives = 92/99 (92.93%), Query Frame = 0
BLAST of Bhi04G000054 vs. NCBI nr
Match: XP_023547192.1 (probable steroid-binding protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 173.3 bits (438), Expect = 4.0e-40 Identity = 84/99 (84.85%), Postives = 91/99 (91.92%), Query Frame = 0
BLAST of Bhi04G000054 vs. NCBI nr
Match: XP_022131551.1 (probable steroid-binding protein 3 [Momordica charantia]) HSP 1 Score: 169.9 bits (429), Expect = 4.5e-39 Identity = 81/99 (81.82%), Postives = 92/99 (92.93%), Query Frame = 0
The following BLAST results are available for this feature:
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |