Bhi03G001875 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAAGACAATATTGCCGAAGGTTATGCAAGTCAAGCACTTTGGTCGTAGTGGGAGAACTAAATGGACACATCTTGTCAAAGAAGATATGACCGACTGGAACAACACGTAAGTCTATTTAACCTAGTTTGCTTTCTGCTTCTCAGTTTCCTATTGTAAATTATTTCAATGTCATTTTTATTTCATAATCGAGTTTATACCCAGATTAAGTACAATATGATCCATTTTAAAAAAAGCTTCTAATGTCTTGTCTACTTATATTGAGAGCGTGTTAAGTAGGGAATGAACAAAAAGAATTGTAGTATGAGCACGAGATTTATAGACGTGCTGGTGTAATAGTGATGTTGAGGCTTTTAGTTTGTTTAAATATCTACATGGGAATATGAAGATATGGTTGGAACAATGCCCTGTTTCCAAAGGGTCTTCTTTGTTTGTTTGTTATTGTTTTTCCCCTTTTTTCTATTCTCATGCGGAAGTTATTCTGCAGTGTGAGTGATGTCAATTGTTTCTGTCATGCAGTTGGACCTATAATGATCCTCTTCGGGCAAAATACAATGCAAAAATGGCTGGAATGAATGCACCAATAGCGAAACCTAAAGGAAGCAAGAAGTTAAAGGATTGGGAATCTCGTTGA ATGGACAAGACAATATTGCCGAAGGTTATGCAAGTCAAGCACTTTGGTCGTAGTGGGAGAACTAAATGGACACATCTTGTCAAAGAAGATATGACCGACTGGAACAACACTTGGACCTATAATGATCCTCTTCGGGCAAAATACAATGCAAAAATGGCTGGAATGAATGCACCAATAGCGAAACCTAAAGGAAGCAAGAAGTTAAAGGATTGGGAATCTCGTTGA ATGGACAAGACAATATTGCCGAAGGTTATGCAAGTCAAGCACTTTGGTCGTAGTGGGAGAACTAAATGGACACATCTTGTCAAAGAAGATATGACCGACTGGAACAACACTTGGACCTATAATGATCCTCTTCGGGCAAAATACAATGCAAAAATGGCTGGAATGAATGCACCAATAGCGAAACCTAAAGGAAGCAAGAAGTTAAAGGATTGGGAATCTCGTTGA MDKTILPKVMQVKHFGRSGRTKWTHLVKEDMTDWNNTWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWESR
BLAST of Bhi03G001875 vs. Swiss-Prot
Match: sp|Q93712|MFAP1_CAEEL (Microfibrillar-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mfap-1 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.8e-12 Identity = 33/69 (47.83%), Postives = 48/69 (69.57%), Query Frame = 0
BLAST of Bhi03G001875 vs. Swiss-Prot
Match: sp|Q9W062|MFAP1_DROME (Microfibrillar-associated protein 1 OS=Drosophila melanogaster OX=7227 GN=Mfap1 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-11 Identity = 36/69 (52.17%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of Bhi03G001875 vs. Swiss-Prot
Match: sp|C0HKD8|MFA1A_MOUSE (Microfibrillar-associated protein 1A OS=Mus musculus OX=10090 GN=Mfap1a PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.8e-10 Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of Bhi03G001875 vs. Swiss-Prot
Match: sp|C0HKD9|MFA1B_MOUSE (Microfibrillar-associated protein 1B OS=Mus musculus OX=10090 GN=Mfap1b PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.8e-10 Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of Bhi03G001875 vs. Swiss-Prot
Match: sp|Q5EA98|MFAP1_BOVIN (Microfibrillar-associated protein 1 OS=Bos taurus OX=9913 GN=MFAP1 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.8e-10 Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of Bhi03G001875 vs. TAIR10
Match: AT5G17900.1 (microfibrillar-associated protein-related) HSP 1 Score: 138.3 bits (347), Expect = 2.0e-33 Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 0
BLAST of Bhi03G001875 vs. TAIR10
Match: AT4G08580.1 (microfibrillar-associated protein-related) HSP 1 Score: 137.1 bits (344), Expect = 4.4e-33 Identity = 61/73 (83.56%), Postives = 67/73 (91.78%), Query Frame = 0
BLAST of Bhi03G001875 vs. TrEMBL
Match: tr|M5WI16|M5WI16_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_4G226700 PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.6e-34 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. TrEMBL
Match: tr|A0A067FS77|A0A067FS77_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g013977mg PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.6e-34 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. TrEMBL
Match: tr|A0A2P5DZK6|A0A2P5DZK6_9ROSA (Micro-fibrillar-associated protein 1, C-terminal OS=Trema orientalis OX=63057 GN=TorRG33x02_237470 PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.6e-34 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. TrEMBL
Match: tr|A0A1S3B4S7|A0A1S3B4S7_CUCME (microfibrillar-associated protein 1 OS=Cucumis melo OX=3656 GN=LOC103486019 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.1e-34 Identity = 70/74 (94.59%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Bhi03G001875 vs. TrEMBL
Match: tr|A0A059AKH0|A0A059AKH0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_J03113 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.1e-34 Identity = 70/74 (94.59%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Bhi03G001875 vs. NCBI nr
Match: XP_021802356.1 (microfibrillar-associated protein 1-like [Prunus avium] >XP_021802357.1 microfibrillar-associated protein 1-like [Prunus avium]) HSP 1 Score: 154.8 bits (390), Expect = 1.1e-34 Identity = 71/74 (95.95%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. NCBI nr
Match: XP_022950647.1 (microfibrillar-associated protein 1-like [Cucurbita moschata]) HSP 1 Score: 154.8 bits (390), Expect = 1.1e-34 Identity = 71/74 (95.95%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. NCBI nr
Match: XP_022978182.1 (microfibrillar-associated protein 1-like [Cucurbita maxima]) HSP 1 Score: 154.8 bits (390), Expect = 1.1e-34 Identity = 71/74 (95.95%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. NCBI nr
Match: XP_023543457.1 (microfibrillar-associated protein 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 154.8 bits (390), Expect = 1.1e-34 Identity = 71/74 (95.95%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Bhi03G001875 vs. NCBI nr
Match: XP_020417408.1 (microfibrillar-associated protein 1 [Prunus persica] >ONI13508.1 hypothetical protein PRUPE_4G226700 [Prunus persica]) HSP 1 Score: 153.7 bits (387), Expect = 2.5e-34 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|