Bhi03G000754 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGTGGTGTTTAGGGCATGGGTTTGGAACTGATCAGTCGGTTTGGAAGCATCTGGTCCCTCACCTAGTGGACGATTATCGAATCGTTTTGTTCGACAACATCGGCGCCGGAACCACCAACCCTGATTACTTTGATTTCGATAGATACTCCACGGTCGAGGGCTGGGCTTATGATCTACTTGCCATTTAG ATGTGGTGGTGTTTAGGGCATGGGTTTGGAACTGATCAGTCGGTTTGGAAGCATCTGGTCCCTCACCTAGTGGACGATTATCGAATCGTTTTGTTCGACAACATCGGCGCCGGAACCACCAACCCTGATTACTTTGATTTCGATAGATACTCCACGGTCGAGGGCTGGGCTTATGATCTACTTGCCATTTAG ATGTGGTGGTGTTTAGGGCATGGGTTTGGAACTGATCAGTCGGTTTGGAAGCATCTGGTCCCTCACCTAGTGGACGATTATCGAATCGTTTTGTTCGACAACATCGGCGCCGGAACCACCAACCCTGATTACTTTGATTTCGATAGATACTCCACGGTCGAGGGCTGGGCTTATGATCTACTTGCCATTTAG MWWCLGHGFGTDQSVWKHLVPHLVDDYRIVLFDNIGAGTTNPDYFDFDRYSTVEGWAYDLLAI
BLAST of Bhi03G000754 vs. Swiss-Prot
Match: sp|Q9SZU7|KAI2_ARATH (Probable esterase KAI2 OS=Arabidopsis thaliana OX=3702 GN=KAI2 PE=1 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 2.2e-27 Identity = 50/59 (84.75%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. Swiss-Prot
Match: sp|Q10J20|D14L_ORYSJ (Probable esterase D14L OS=Oryza sativa subsp. japonica OX=39947 GN=D14L PE=1 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 2.3e-24 Identity = 48/59 (81.36%), Postives = 53/59 (89.83%), Query Frame = 0
BLAST of Bhi03G000754 vs. Swiss-Prot
Match: sp|Q9SQR3|D14_ARATH (Strigolactone esterase D14 OS=Arabidopsis thaliana OX=3702 GN=D14 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.7e-15 Identity = 32/59 (54.24%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of Bhi03G000754 vs. Swiss-Prot
Match: sp|Q10QA5|D14_ORYSJ (Strigolactone esterase D14 OS=Oryza sativa subsp. japonica OX=39947 GN=D14 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 7.4e-15 Identity = 32/59 (54.24%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Bhi03G000754 vs. Swiss-Prot
Match: sp|J9U5U9|DAD2_PETHY (Probable strigolactone esterase DAD2 OS=Petunia hybrida OX=4102 GN=DAD2 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 9.7e-15 Identity = 32/59 (54.24%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Bhi03G000754 vs. TAIR10
Match: AT4G37470.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 122.1 bits (305), Expect = 1.2e-28 Identity = 50/59 (84.75%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. TAIR10
Match: AT3G03990.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 80.9 bits (198), Expect = 3.1e-16 Identity = 32/59 (54.24%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of Bhi03G000754 vs. TAIR10
Match: AT3G24420.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 50.1 bits (118), Expect = 6.0e-07 Identity = 20/60 (33.33%), Postives = 40/60 (66.67%), Query Frame = 0
BLAST of Bhi03G000754 vs. TrEMBL
Match: tr|A0A1S3B3F2|A0A1S3B3F2_CUCME (probable esterase D14L OS=Cucumis melo OX=3656 GN=LOC103485336 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.7e-27 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. TrEMBL
Match: tr|A0A0A0KLG6|A0A0A0KLG6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G493890 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 6.3e-27 Identity = 56/59 (94.92%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. TrEMBL
Match: tr|M4CKN0|M4CKN0_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis OX=51351 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 9.1e-26 Identity = 53/59 (89.83%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of Bhi03G000754 vs. TrEMBL
Match: tr|A0A1J3GBM1|A0A1J3GBM1_NOCCA (Putative esterase KAI2 (Fragment) OS=Noccaea caerulescens OX=107243 GN=LE_TR20772_c12_g1_i1_g.67071 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.2e-25 Identity = 52/59 (88.14%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of Bhi03G000754 vs. TrEMBL
Match: tr|A0A1J3F3Y4|A0A1J3F3Y4_NOCCA (Putative esterase KAI2 OS=Noccaea caerulescens OX=107243 GN=LC_TR11207_c0_g1_i1_g.39368 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.2e-25 Identity = 52/59 (88.14%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of Bhi03G000754 vs. NCBI nr
Match: XP_022132576.1 (probable esterase D14L [Momordica charantia]) HSP 1 Score: 131.3 bits (329), Expect = 1.1e-27 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. NCBI nr
Match: XP_008441109.1 (PREDICTED: probable esterase D14L [Cucumis melo]) HSP 1 Score: 130.2 bits (326), Expect = 2.5e-27 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. NCBI nr
Match: XP_004141889.1 (PREDICTED: probable esterase D14L [Cucumis sativus] >KGN48581.1 hypothetical protein Csa_6G493890 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 9.5e-27 Identity = 56/59 (94.92%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of Bhi03G000754 vs. NCBI nr
Match: XP_021714410.1 (probable esterase KAI2 [Chenopodium quinoa]) HSP 1 Score: 124.8 bits (312), Expect = 1.0e-25 Identity = 52/59 (88.14%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of Bhi03G000754 vs. NCBI nr
Match: XP_021735086.1 (probable esterase KAI2 [Chenopodium quinoa]) HSP 1 Score: 124.8 bits (312), Expect = 1.0e-25 Identity = 52/59 (88.14%), Postives = 59/59 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |