Bhi02G001696 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTAAAGGAATACCCAGAAACACATCTACAAAAGCTTCGTATCGGAATCTACAAAGAAACGATCCAATTGATCAAGATGCACAATGAGGATCGTATCCATACGTGAAGACGTGACAGAGGGGATCGTGACCTTACAAAAGAACCCATAGTTCATGAGGATCAAAACCCTATCAGAGAACTTAAAGTATGTGAGGATCATGACTCTATTAGGAAACCAATAGCATGGGAAACCATGTCTGAGGGAGAGGCTAGTACCCCTCAAGATAGAGTAACATGGAGAATATTTGACAGAATAGTGCAAAGATTAGCTGCCAGT ATGCTAAAGGAATACCCAGAAACACATCTACAAAAGCTTCGTATCGGAATCTACAAAGAAACGATCCAATTGATCAAGATGCACAATGAGGATCGGGATCGTGACCTTACAAAAGAACCCATAGTTCATGAGGATCAAAACCCTATCAGAGAACTTAAAGTATGTGAGGATCATGACTCTATTAGGAAACCAATAGCATGGGAAACCATGTCTGAGGGAGAGGCTAGTACCCCTCAAGATAGAGTAACATGGAGAATATTTGACAGAATAGTGCAAAGATTAGCTGCCAGT ATGCTAAAGGAATACCCAGAAACACATCTACAAAAGCTTCGTATCGGAATCTACAAAGAAACGATCCAATTGATCAAGATGCACAATGAGGATCGGGATCGTGACCTTACAAAAGAACCCATAGTTCATGAGGATCAAAACCCTATCAGAGAACTTAAAGTATGTGAGGATCATGACTCTATTAGGAAACCAATAGCATGGGAAACCATGTCTGAGGGAGAGGCTAGTACCCCTCAAGATAGAGTAACATGGAGAATATTTGACAGAATAGTGCAAAGATTAGCTGCCAGT MLKEYPETHLQKLRIGIYKETIQLIKMHNEDRDRDLTKEPIVHEDQNPIRELKVCEDHDSIRKPIAWETMSEGEASTPQDRVTWRIFDRIVQRLAAS
BLAST of Bhi02G001696 vs. Swiss-Prot
Match: sp|Q2QD77|CEMA_CUCSA (Chloroplast envelope membrane protein OS=Cucumis sativus OX=3659 GN=cemA PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.2e-09 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi02G001696 vs. Swiss-Prot
Match: sp|Q71E53|CEMA_FAGSY (Chloroplast envelope membrane protein OS=Fagus sylvatica OX=28930 GN=cemA PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.2e-09 Identity = 28/31 (90.32%), Postives = 30/31 (96.77%), Query Frame = 0
BLAST of Bhi02G001696 vs. Swiss-Prot
Match: sp|B1NWG2|CEMA_MANES (Chloroplast envelope membrane protein OS=Manihot esculenta OX=3983 GN=cemA PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.2e-09 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of Bhi02G001696 vs. Swiss-Prot
Match: sp|Q14FE5|CEMA_POPAL (Chloroplast envelope membrane protein OS=Populus alba OX=43335 GN=cemA PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.5e-09 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi02G001696 vs. Swiss-Prot
Match: sp|A4GYS3|CEMA_POPTR (Chloroplast envelope membrane protein OS=Populus trichocarpa OX=3694 GN=cemA PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.5e-09 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi02G001696 vs. TAIR10
Match: ATCG00530.1 (CemA-like proton extrusion protein-related) HSP 1 Score: 51.6 bits (122), Expect = 3.2e-07 Identity = 22/30 (73.33%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of Bhi02G001696 vs. TrEMBL
Match: tr|X2F1U1|X2F1U1_LAGSI (envelope membrane protein, chloroplastic OS=Lagenaria siceraria OX=3668 GN=cemA PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. TrEMBL
Match: tr|A0A286NFS5|A0A286NFS5_CUCME (envelope membrane protein, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=cemA PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. TrEMBL
Match: tr|A0A249RXP0|A0A249RXP0_CUCME (envelope membrane protein, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=cemA PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. TrEMBL
Match: tr|A0A0S2IFX5|A0A0S2IFX5_CUCMO (CemA OS=Cucurbita moschata OX=3662 GN=cemA PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. TrEMBL
Match: tr|A0A1P8LFF7|A0A1P8LFF7_CITLA (Envelope membrane protein OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=cemA PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. NCBI nr
Match: YP_004072474.1 (potential heme-binding protein (chloroplast) [Corynocarpus laevigatus] >ADO60322.1 potential heme-binding protein (chloroplast) [Corynocarpus laevigatus]) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. NCBI nr
Match: AXR94515.1 (envelope membrane protein (chloroplast) [Hodgsonia macrocarpa] >AXR94600.1 envelope membrane protein (chloroplast) [Hodgsonia macrocarpa] >AXR94684.1 envelope membrane protein (chloroplast) [Hodgsonia macrocarpa] >AXR94769.1 envelope membrane protein (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. NCBI nr
Match: YP_009456158.1 (envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM88703.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM88935.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM88993.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89052.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89111.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89170.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89229.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89288.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89348.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89407.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89466.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89525.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89585.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89644.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89703.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89762.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89821.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89880.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89939.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM89998.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90057.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90116.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90175.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90234.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90293.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90352.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90411.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90470.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90529.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90588.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90647.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90706.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90765.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90824.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90883.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM90942.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM91001.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM91060.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AHM91293.1 chloroplast envelope membrane protein (chloroplast) [Lagenaria siceraria] >AUJ21924.1 envelope membrane protein (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. NCBI nr
Match: AHM88762.1 (chloroplast envelope membrane protein, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi02G001696 vs. NCBI nr
Match: AHM88820.1 (chloroplast envelope membrane protein, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-08 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|