Bhi02G001371 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTGGATGTGGCAATGACAGAGGACCTAATTGCGTATAATATTATTCCATTAGATGCCCCTTCTGTGACAAATGCTATTGGGTCCTTGGCTGAGGTCTTTTAGATGACAATTTTCTTGTTTGAAATGTGAAAGTTTTACCCGTTTCTTCTGTTGTTTACCTTGAAACTGAACTTTTTTGTTAGGTGCAAGCATCAGTGTCAGCTTTAAAGTATTTCAGTGGCCTTCCAAAGTTGCCCGCAGATTTTTCTATTCCGGAGACTAGGAGTCCTGATATACTTGACTTTCTACACTTCGTTTTTGGATTTCAGGTTTGGATTTCTATGTTGGGTGGTTATATAGAACCCTATCCAGTCCACTAA ATGGAATTGGATGTGGCAATGACAGAGGACCTAATTGCGTATAATATTATTCCATTAGATGCCCCTTCTGTGACAAATGCTATTGGGTCCTTGGCTGAGGTGCAAGCATCAGTGTCAGCTTTAAAGTATTTCAGTGGCCTTCCAAAGTTGCCCGCAGATTTTTCTATTCCGGAGACTAGGAGTCCTGATATACTTGACTTTCTACACTTCGTTTTTGGATTTCAGGTTTGGATTTCTATGTTGGGTGGTTATATAGAACCCTATCCAGTCCACTAA ATGGAATTGGATGTGGCAATGACAGAGGACCTAATTGCGTATAATATTATTCCATTAGATGCCCCTTCTGTGACAAATGCTATTGGGTCCTTGGCTGAGGTGCAAGCATCAGTGTCAGCTTTAAAGTATTTCAGTGGCCTTCCAAAGTTGCCCGCAGATTTTTCTATTCCGGAGACTAGGAGTCCTGATATACTTGACTTTCTACACTTCGTTTTTGGATTTCAGGTTTGGATTTCTATGTTGGGTGGTTATATAGAACCCTATCCAGTCCACTAA MELDVAMTEDLIAYNIIPLDAPSVTNAIGSLAEVQASVSALKYFSGLPKLPADFSIPETRSPDILDFLHFVFGFQVWISMLGGYIEPYPVH
BLAST of Bhi02G001371 vs. Swiss-Prot
Match: sp|Q9SFU6|CALS9_ARATH (Callose synthase 9 OS=Arabidopsis thaliana OX=3702 GN=CALS9 PE=2 SV=2) HSP 1 Score: 107.5 bits (267), Expect = 8.2e-23 Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. Swiss-Prot
Match: sp|Q9SJM0|CALSA_ARATH (Callose synthase 10 OS=Arabidopsis thaliana OX=3702 GN=CALS10 PE=2 SV=5) HSP 1 Score: 74.3 bits (181), Expect = 7.7e-13 Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 0
BLAST of Bhi02G001371 vs. Swiss-Prot
Match: sp|Q9AUE0|CALS1_ARATH (Callose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=CALS1 PE=1 SV=2) HSP 1 Score: 48.9 bits (115), Expect = 3.5e-05 Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of Bhi02G001371 vs. Swiss-Prot
Match: sp|Q9SL03|CALS2_ARATH (Callose synthase 2 OS=Arabidopsis thaliana OX=3702 GN=CALS2 PE=2 SV=3) HSP 1 Score: 47.0 bits (110), Expect = 1.3e-04 Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of Bhi02G001371 vs. Swiss-Prot
Match: sp|Q9LUD7|CALS8_ARATH (Putative callose synthase 8 OS=Arabidopsis thaliana OX=3702 GN=CALS8 PE=3 SV=2) HSP 1 Score: 46.6 bits (109), Expect = 1.7e-04 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. TAIR10
Match: AT3G07160.1 (glucan synthase-like 10) HSP 1 Score: 107.5 bits (267), Expect = 4.5e-24 Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. TAIR10
Match: AT2G36850.1 (glucan synthase-like 8) HSP 1 Score: 74.3 bits (181), Expect = 4.3e-14 Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 0
BLAST of Bhi02G001371 vs. TAIR10
Match: AT1G05570.1 (callose synthase 1) HSP 1 Score: 48.9 bits (115), Expect = 1.9e-06 Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of Bhi02G001371 vs. TAIR10
Match: AT2G31960.1 (glucan synthase-like 3) HSP 1 Score: 47.0 bits (110), Expect = 7.3e-06 Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of Bhi02G001371 vs. TAIR10
Match: AT3G14570.1 (glucan synthase-like 4) HSP 1 Score: 46.6 bits (109), Expect = 9.5e-06 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. TrEMBL
Match: tr|A0A1S4DYC5|A0A1S4DYC5_CUCME (callose synthase 9 OS=Cucumis melo OX=3656 GN=LOC103492488 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 3.7e-28 Identity = 65/75 (86.67%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. TrEMBL
Match: tr|A0A0A0LX29|A0A0A0LX29_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G605100 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 6.3e-28 Identity = 64/75 (85.33%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. TrEMBL
Match: tr|A0A2P6QMV8|A0A2P6QMV8_ROSCH (Putative 1,3-beta-glucan synthase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr5g0080681 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 2.6e-26 Identity = 61/75 (81.33%), Postives = 66/75 (88.00%), Query Frame = 0
BLAST of Bhi02G001371 vs. TrEMBL
Match: tr|M5W2E0|M5W2E0_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppa024887mg PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.7e-25 Identity = 60/75 (80.00%), Postives = 65/75 (86.67%), Query Frame = 0
BLAST of Bhi02G001371 vs. TrEMBL
Match: tr|A0A251NIL5|A0A251NIL5_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G014200 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.7e-25 Identity = 60/75 (80.00%), Postives = 65/75 (86.67%), Query Frame = 0
BLAST of Bhi02G001371 vs. NCBI nr
Match: XP_022966575.1 (callose synthase 9-like isoform X3 [Cucurbita maxima]) HSP 1 Score: 136.3 bits (342), Expect = 5.0e-29 Identity = 66/75 (88.00%), Postives = 71/75 (94.67%), Query Frame = 0
BLAST of Bhi02G001371 vs. NCBI nr
Match: XP_022966560.1 (callose synthase 9-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 136.3 bits (342), Expect = 5.0e-29 Identity = 66/75 (88.00%), Postives = 71/75 (94.67%), Query Frame = 0
BLAST of Bhi02G001371 vs. NCBI nr
Match: XP_022966567.1 (callose synthase 9-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 136.3 bits (342), Expect = 5.0e-29 Identity = 66/75 (88.00%), Postives = 71/75 (94.67%), Query Frame = 0
BLAST of Bhi02G001371 vs. NCBI nr
Match: XP_022929574.1 (LOW QUALITY PROTEIN: callose synthase 9-like [Cucurbita moschata]) HSP 1 Score: 136.0 bits (341), Expect = 6.6e-29 Identity = 66/75 (88.00%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of Bhi02G001371 vs. NCBI nr
Match: XP_022966547.1 (LOW QUALITY PROTEIN: callose synthase 9-like [Cucurbita maxima]) HSP 1 Score: 136.0 bits (341), Expect = 6.6e-29 Identity = 66/75 (88.00%), Postives = 70/75 (93.33%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|