Bhi02G000995 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTTATGCCATGATCAGTATAGGTGTTCTTAGATCTCTTGTTTGGGCTCATCATATGTTTACTATGGGCTTAGATGTTGATACCGTGCCTACTTCACTGCTGCTACCATGATCATAGCAGTCCCCACTGGAATCAAAATCTTTAGTTGGATCGCTACCATGTGGGGGGGTTCGATACAATACAAAACACCCATGTTATTTGCTGTAGGGTCCATCTTTTTGTTCACCATAGGAGGACTCACTGGAATAATCCCGGCAAATTCAGGGCTAGACATTGCTCTACATGATACTTATTAGTGATTGCACATTTTCATTATATACTTTCTATGGGAGCCATTTTTGCTTTATTTGCAGGATTTCACTATTGGGTGGGTAAAATCTTTGGTCGGACATACCCTGAAACTTTAGGTCAAATCCATTTTTGGATCACATTTTTCGAGGTTAATCCGACCCTCTTTCCCATGAATTTCTTAGGGCTTTCGGGTATGCCACGTCGCATTCCTGATTATCCAGATGCTTACGCTGGATGGAATGCCCTTAGCAGTTTTGGCTCTTATATATCCGTAGTTGGGATTCGTCGTTTCTTCGTGGTCGTAACAATCACTTCAAGCAGTGGAAATAACAAAAGATGTGCTCTAAGTCCTTGGGCTGTTGAACAGAATTCAACCACACTGGAATGGATGGTACAAAGTCCTCCAGCTTTTCATACTTTTGGAGAACTTCCAGCTATCAAGGAGACGAAAAGCTATGTGAAGTAA ATGGTTTATGCCATGATCAGATTTCACTATTGGGTGGGTAAAATCTTTGGTCGGACATACCCTGAAACTTTAGGTCAAATCCATTTTTGGATCACATTTTTCGAGGTTAATCCGACCCTCTTTCCCATGAATTTCTTAGGGCTTTCGGGTATGCCACGTCGCATTCCTGATTATCCAGATGCTTACGCTGGATGGAATGCCCTTAGCAGTTTTGGCTCTTATATATCCGTAGTTGGGATTCGTCGTTTCTTCGTGGTCGTAACAATCACTTCAAGCAGTGGAAATAACAAAAGATGTGCTCTAAGTCCTTGGGCTGTTGAACAGAATTCAACCACACTGGAATGGATGGTACAAAGTCCTCCAGCTTTTCATACTTTTGGAGAACTTCCAGCTATCAAGGAGACGAAAAGCTATGTGAAGTAA ATGGTTTATGCCATGATCAGATTTCACTATTGGGTGGGTAAAATCTTTGGTCGGACATACCCTGAAACTTTAGGTCAAATCCATTTTTGGATCACATTTTTCGAGGTTAATCCGACCCTCTTTCCCATGAATTTCTTAGGGCTTTCGGGTATGCCACGTCGCATTCCTGATTATCCAGATGCTTACGCTGGATGGAATGCCCTTAGCAGTTTTGGCTCTTATATATCCGTAGTTGGGATTCGTCGTTTCTTCGTGGTCGTAACAATCACTTCAAGCAGTGGAAATAACAAAAGATGTGCTCTAAGTCCTTGGGCTGTTGAACAGAATTCAACCACACTGGAATGGATGGTACAAAGTCCTCCAGCTTTTCATACTTTTGGAGAACTTCCAGCTATCAAGGAGACGAAAAGCTATGTGAAGTAA MVYAMIRFHYWVGKIFGRTYPETLGQIHFWITFFEVNPTLFPMNFLGLSGMPRRIPDYPDAYAGWNALSSFGSYISVVGIRRFFVVVTITSSSGNNKRCALSPWAVEQNSTTLEWMVQSPPAFHTFGELPAIKETKSYVK
BLAST of Bhi02G000995 vs. Swiss-Prot
Match: sp|P08743|COX1_OENBE (Cytochrome c oxidase subunit 1 OS=Oenothera berteroana OX=3950 GN=COX1 PE=3 SV=2) HSP 1 Score: 261.2 bits (666), Expect = 6.8e-69 Identity = 122/133 (91.73%), Postives = 126/133 (94.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. Swiss-Prot
Match: sp|P07506|COX1_SOYBN (Cytochrome c oxidase subunit 1 OS=Glycine max OX=3847 GN=COX1 PE=3 SV=3) HSP 1 Score: 260.4 bits (664), Expect = 1.2e-68 Identity = 124/133 (93.23%), Postives = 126/133 (94.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. Swiss-Prot
Match: sp|P12786|COX1_PEA (Cytochrome c oxidase subunit 1 OS=Pisum sativum OX=3888 GN=COX1 PE=3 SV=2) HSP 1 Score: 258.8 bits (660), Expect = 3.4e-68 Identity = 123/133 (92.48%), Postives = 126/133 (94.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. Swiss-Prot
Match: sp|P60620|COX1_ARATH (Cytochrome c oxidase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=COX1 PE=3 SV=1) HSP 1 Score: 257.7 bits (657), Expect = 7.5e-68 Identity = 122/133 (91.73%), Postives = 125/133 (93.98%), Query Frame = 0
BLAST of Bhi02G000995 vs. Swiss-Prot
Match: sp|P60621|COX1_RAPSA (Cytochrome c oxidase subunit 1 OS=Raphanus sativus OX=3726 GN=COX1 PE=3 SV=1) HSP 1 Score: 257.7 bits (657), Expect = 7.5e-68 Identity = 122/133 (91.73%), Postives = 125/133 (93.98%), Query Frame = 0
BLAST of Bhi02G000995 vs. TAIR10
Match: ATMG01360.1 (cytochrome oxidase) HSP 1 Score: 257.7 bits (657), Expect = 4.2e-69 Identity = 122/133 (91.73%), Postives = 125/133 (93.98%), Query Frame = 0
BLAST of Bhi02G000995 vs. TrEMBL
Match: tr|A0A109RUC7|A0A109RUC7_9FABA (Cytochrome c oxidase subunit 1 OS=Senna marilandica OX=1789066 PE=3 SV=1) HSP 1 Score: 276.6 bits (706), Expect = 3.2e-71 Identity = 129/133 (96.99%), Postives = 131/133 (98.50%), Query Frame = 0
BLAST of Bhi02G000995 vs. TrEMBL
Match: tr|A0A0X8GIK9|A0A0X8GIK9_9ROSI (Cytochrome c oxidase subunit 1 OS=Croton texensis OX=504260 PE=3 SV=1) HSP 1 Score: 276.2 bits (705), Expect = 4.1e-71 Identity = 129/133 (96.99%), Postives = 130/133 (97.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. TrEMBL
Match: tr|B9U3L8|B9U3L8_CARPA (Cytochrome c oxidase subunit 1 OS=Carica papaya OX=3649 GN=cox1 PE=3 SV=1) HSP 1 Score: 275.0 bits (702), Expect = 9.2e-71 Identity = 129/133 (96.99%), Postives = 130/133 (97.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. TrEMBL
Match: tr|A0A219YLV0|A0A219YLV0_9MYRT (Cytochrome c oxidase subunit 1 OS=Lagerstroemia indica OX=141186 GN=cox1 PE=3 SV=1) HSP 1 Score: 274.6 bits (701), Expect = 1.2e-70 Identity = 129/133 (96.99%), Postives = 130/133 (97.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. TrEMBL
Match: tr|A0A0X8GIH0|A0A0X8GIH0_EUPMA (Cytochrome c oxidase subunit 1 OS=Euphorbia marginata OX=28955 PE=3 SV=1) HSP 1 Score: 274.2 bits (700), Expect = 1.6e-70 Identity = 128/133 (96.24%), Postives = 129/133 (96.99%), Query Frame = 0
BLAST of Bhi02G000995 vs. NCBI nr
Match: YP_009498144.1 (cytochrome c oxidase subunit 1 (mitochondrion) [Senna tora] >YP_009504848.1 Cox1 (mitochondrion) [Senna occidentalis] >AMC32816.1 cytochrome c oxidase subunit 1 (mitochondrion) [Senna marilandica] >AWW13946.1 cytochrome c oxidase subunit 1 (mitochondrion) [Senna tora] >AWW13969.1 Cox1 (mitochondrion) [Senna occidentalis]) HSP 1 Score: 276.6 bits (706), Expect = 4.8e-71 Identity = 129/133 (96.99%), Postives = 131/133 (98.50%), Query Frame = 0
BLAST of Bhi02G000995 vs. NCBI nr
Match: AMC32792.1 (cytochrome c oxidase subunit 1 (mitochondrion) [Croton texensis]) HSP 1 Score: 276.2 bits (705), Expect = 6.3e-71 Identity = 129/133 (96.99%), Postives = 130/133 (97.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. NCBI nr
Match: YP_002608199.1 (cytochrome c oxidase subunit 1 [Carica papaya] >ACB20488.1 cytochrome c oxidase subunit 1 (mitochondrion) [Carica papaya]) HSP 1 Score: 275.0 bits (702), Expect = 1.4e-70 Identity = 129/133 (96.99%), Postives = 130/133 (97.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. NCBI nr
Match: YP_009414444.1 (cytochrome c oxidase subunit 1 (mitochondrion) [Lagerstroemia indica] >AQS99548.1 cytochrome c oxidase subunit 1 (mitochondrion) [Lagerstroemia indica]) HSP 1 Score: 274.6 bits (701), Expect = 1.8e-70 Identity = 129/133 (96.99%), Postives = 130/133 (97.74%), Query Frame = 0
BLAST of Bhi02G000995 vs. NCBI nr
Match: AMC32794.1 (cytochrome c oxidase subunit 1 (mitochondrion) [Euphorbia marginata]) HSP 1 Score: 274.2 bits (700), Expect = 2.4e-70 Identity = 128/133 (96.24%), Postives = 129/133 (96.99%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |