Bhi01G002416 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTAAATTAGAGGAGTTGGTTTTGTTGGACTTGTGGTTTAGCCCTTTTGCAATGAGAGTGAGGGTGGCTTTGGCAGAAAAAGGCATAAAATATGAAGGAAAAGAGGAAGATTTGAGCAACAAAAGCCCTTTGCTTTTGGAGATGAATCCTATTAACAAGCAAATCCCAGTTTTGATACACAAAGGGAAGCCCATTATTGAATCCTCTCCCATAGTTGAGTATATTGATGAGATTAGGAGTGATGATGAGGGAACTTATACTAATTTGCTTCCTTCTCATCCTTTTGACAGAGCCCATGCTAGGTTTTGA ATGAGTAAATTAGAGGAGTTGGTTTTGTTGGACTTGTGGTTTAGCCCTTTTGCAATGAGAGTGAGGGTGGCTTTGGCAGAAAAAGGCATAAAATATGAAGGAAAAGAGGAAGATTTGAGCAACAAAAGCCCTTTGCTTTTGGAGATGAATCCTATTAACAAGCAAATCCCAGTTTTGATACACAAAGGGAAGCCCATTATTGAATCCTCTCCCATAGTTGAGTATATTGATGAGATTAGGAGTGATGATGAGGGAACTTATACTAATTTGCTTCCTTCTCATCCTTTTGACAGAGCCCATGCTAGGTTTTGA ATGAGTAAATTAGAGGAGTTGGTTTTGTTGGACTTGTGGTTTAGCCCTTTTGCAATGAGAGTGAGGGTGGCTTTGGCAGAAAAAGGCATAAAATATGAAGGAAAAGAGGAAGATTTGAGCAACAAAAGCCCTTTGCTTTTGGAGATGAATCCTATTAACAAGCAAATCCCAGTTTTGATACACAAAGGGAAGCCCATTATTGAATCCTCTCCCATAGTTGAGTATATTGATGAGATTAGGAGTGATGATGAGGGAACTTATACTAATTTGCTTCCTTCTCATCCTTTTGACAGAGCCCATGCTAGGTTTTGA MSKLEELVLLDLWFSPFAMRVRVALAEKGIKYEGKEEDLSNKSPLLLEMNPINKQIPVLIHKGKPIIESSPIVEYIDEIRSDDEGTYTNLLPSHPFDRAHARF
BLAST of Bhi01G002416 vs. TAIR10
Match: AT1G78320.1 (glutathione S-transferase TAU 23) HSP 1 Score: 120.9 bits (302), Expect = 4.5e-28 Identity = 63/100 (63.00%), Postives = 77/100 (77.00%), Query Frame = 0
BLAST of Bhi01G002416 vs. TAIR10
Match: AT1G78340.1 (glutathione S-transferase TAU 22) HSP 1 Score: 119.8 bits (299), Expect = 1.0e-27 Identity = 56/99 (56.57%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Bhi01G002416 vs. TAIR10
Match: AT1G17170.1 (glutathione S-transferase TAU 24) HSP 1 Score: 118.2 bits (295), Expect = 2.9e-27 Identity = 59/99 (59.60%), Postives = 74/99 (74.75%), Query Frame = 0
BLAST of Bhi01G002416 vs. TAIR10
Match: AT1G78380.1 (glutathione S-transferase TAU 19) HSP 1 Score: 113.2 bits (282), Expect = 9.4e-26 Identity = 58/98 (59.18%), Postives = 73/98 (74.49%), Query Frame = 0
BLAST of Bhi01G002416 vs. TAIR10
Match: AT1G17180.1 (glutathione S-transferase TAU 25) HSP 1 Score: 111.7 bits (278), Expect = 2.7e-25 Identity = 54/99 (54.55%), Postives = 73/99 (73.74%), Query Frame = 0
BLAST of Bhi01G002416 vs. Swiss-Prot
Match: sp|Q03666|GSTX4_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 3.0e-29 Identity = 67/99 (67.68%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Bhi01G002416 vs. Swiss-Prot
Match: sp|P49332|GSTXC_TOBAC (Probable glutathione S-transferase parC OS=Nicotiana tabacum OX=4097 GN=PARC PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-28 Identity = 65/99 (65.66%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Bhi01G002416 vs. Swiss-Prot
Match: sp|P46417|GSTX3_SOYBN (Glutathione S-transferase 3 OS=Glycine max OX=3847 GN=GST3 PE=1 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.8e-27 Identity = 60/99 (60.61%), Postives = 79/99 (79.80%), Query Frame = 0
BLAST of Bhi01G002416 vs. Swiss-Prot
Match: sp|Q9M9F1|GSTUN_ARATH (Glutathione S-transferase U23 OS=Arabidopsis thaliana OX=3702 GN=GSTU23 PE=1 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 8.1e-27 Identity = 63/100 (63.00%), Postives = 77/100 (77.00%), Query Frame = 0
BLAST of Bhi01G002416 vs. Swiss-Prot
Match: sp|Q8GYM1|GSTUM_ARATH (Glutathione S-transferase U22 OS=Arabidopsis thaliana OX=3702 GN=GSTU22 PE=1 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.8e-26 Identity = 56/99 (56.57%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Bhi01G002416 vs. TrEMBL
Match: tr|Q8H9E6|Q8H9E6_CUCMA (Glutathione S-transferse OS=Cucurbita maxima OX=3661 GN=Pugb PE=2 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 2.8e-32 Identity = 75/103 (72.82%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of Bhi01G002416 vs. TrEMBL
Match: tr|A0A1R3JCW3|A0A1R3JCW3_9ROSI (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_17396 PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 8.1e-32 Identity = 72/99 (72.73%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of Bhi01G002416 vs. TrEMBL
Match: tr|A0A2G2Z515|A0A2G2Z515_CAPAN (probable glutathione S-transferase parC OS=Capsicum annuum OX=4072 GN=LOC107852043 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 9.9e-30 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Bhi01G002416 vs. TrEMBL
Match: tr|A0A2G3C281|A0A2G3C281_CAPCH (Putative glutathione S-transferase OS=Capsicum chinense OX=80379 GN=BC332_19767 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 9.9e-30 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Bhi01G002416 vs. TrEMBL
Match: tr|A0A1U8EZP2|A0A1U8EZP2_CAPAN (Putative glutathione S-transferase OS=Capsicum annuum OX=4072 GN=T459_20467 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 9.9e-30 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Bhi01G002416 vs. NCBI nr
Match: XP_022142788.1 (probable glutathione S-transferase [Momordica charantia]) HSP 1 Score: 166.8 bits (421), Expect = 3.9e-38 Identity = 84/105 (80.00%), Postives = 92/105 (87.62%), Query Frame = 0
BLAST of Bhi01G002416 vs. NCBI nr
Match: XP_022942110.1 (probable glutathione S-transferase [Cucurbita moschata]) HSP 1 Score: 147.9 bits (372), Expect = 1.9e-32 Identity = 77/103 (74.76%), Postives = 86/103 (83.50%), Query Frame = 0
BLAST of Bhi01G002416 vs. NCBI nr
Match: XP_022982585.1 (probable glutathione S-transferase [Cucurbita maxima] >BAC21262.1 glutathione S-transferse [Cucurbita maxima]) HSP 1 Score: 146.7 bits (369), Expect = 4.2e-32 Identity = 75/103 (72.82%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of Bhi01G002416 vs. NCBI nr
Match: OMO92668.1 (hypothetical protein COLO4_17396 [Corchorus olitorius]) HSP 1 Score: 145.2 bits (365), Expect = 1.2e-31 Identity = 72/99 (72.73%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of Bhi01G002416 vs. NCBI nr
Match: XP_023523935.1 (probable glutathione S-transferase [Cucurbita pepo subsp. pepo]) HSP 1 Score: 144.8 bits (364), Expect = 1.6e-31 Identity = 74/103 (71.84%), Postives = 86/103 (83.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|