Bhi01G001446 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCAGTACCGATTCTTATAGTACTGTTCGGGGAGTCAATAAGTTAATTCCTGTTGATGTGTATTTGCCGGGTTGTCCACCTAAACCCGATGCTATAACAAAACTTCGTAAGAAAATATCTCGAGAAATCTATGAAGATCGAATTAAGTCTCAAGAGGAGAATCGGTGTTTTACGACCAACCACAAATTTCATGTTGGCAATCGACGAGGGATATTCAAAGCATCTAGGAAGAAAGGACGAGCGGTTACTCTAGCAACAGATACGTTCTAA ATGTTCAGTACCGATTCTTATAGTACTGTTCGGGGAGTCAATAAGTTAATTCCTGTTGATGTGTATTTGCCGGGTTGTCCACCTAAACCCGATGCTATAACAAAACTTCGTAAGAAAATATCTCGAGAAATCTATGAAGATCGAATTAAGTCTCAAGAGGAGAATCGGTGTTTTACGACCAACCACAAATTTCATGTTGGCAATCGACGAGGGATATTCAAAGCATCTAGGAAGAAAGGACGAGCGGTTACTCTAGCAACAGATACGTTCTAA ATGTTCAGTACCGATTCTTATAGTACTGTTCGGGGAGTCAATAAGTTAATTCCTGTTGATGTGTATTTGCCGGGTTGTCCACCTAAACCCGATGCTATAACAAAACTTCGTAAGAAAATATCTCGAGAAATCTATGAAGATCGAATTAAGTCTCAAGAGGAGAATCGGTGTTTTACGACCAACCACAAATTTCATGTTGGCAATCGACGAGGGATATTCAAAGCATCTAGGAAGAAAGGACGAGCGGTTACTCTAGCAACAGATACGTTCTAA MFSTDSYSTVRGVNKLIPVDVYLPGCPPKPDAITKLRKKISREIYEDRIKSQEENRCFTTNHKFHVGNRRGIFKASRKKGRAVTLATDTF
BLAST of Bhi01G001446 vs. TAIR10
Match: ATCG00430.1 (photosystem II reaction center protein G) HSP 1 Score: 120.9 bits (302), Expect = 3.9e-28 Identity = 60/78 (76.92%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of Bhi01G001446 vs. TAIR10
Match: AT5G11770.1 (NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial) HSP 1 Score: 50.1 bits (118), Expect = 8.5e-07 Identity = 21/41 (51.22%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of Bhi01G001446 vs. Swiss-Prot
Match: sp|Q4VZH1|NDHK_CUCSA (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhK PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.6e-31 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. Swiss-Prot
Match: sp|B0Z4L3|NDHK_OENAR (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera argillicola OX=3940 GN=ndhK PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.1e-31 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. Swiss-Prot
Match: sp|B0Z4U7|NDHK_OENBI (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera biennis OX=3942 GN=ndhK PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.1e-31 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. Swiss-Prot
Match: sp|Q9MTP4|NDHK_OENEH (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera elata subsp. hookeri OX=85636 GN=ndhK PE=3 SV=2) HSP 1 Score: 134.0 bits (336), Expect = 8.1e-31 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. Swiss-Prot
Match: sp|B0Z531|NDHK_OENGL (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera glazioviana OX=482428 GN=ndhK PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.1e-31 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. TrEMBL
Match: tr|A0A0S2IER2|A0A0S2IER2_9ROSI (NADH-quinone oxidoreductase subunit B OS=Cucurbita ficifolia OX=37645 GN=ndhK PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 5.6e-29 Identity = 66/72 (91.67%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of Bhi01G001446 vs. TrEMBL
Match: tr|A0A249RY14|A0A249RY14_CUCME (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=ndhK PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 7.3e-29 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. TrEMBL
Match: tr|A0A286NG00|A0A286NG00_CUCME (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=ndhK PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 7.3e-29 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. TrEMBL
Match: tr|A0A0S2IFB3|A0A0S2IFB3_CUCMO (NADH-quinone oxidoreductase subunit B OS=Cucurbita moschata OX=3662 GN=ndhK PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 7.3e-29 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. TrEMBL
Match: tr|A0A1P8LDQ2|A0A1P8LDQ2_CITLA (NADH-quinone oxidoreductase subunit B OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=ndhK PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 7.3e-29 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. NCBI nr
Match: ALO22094.1 (NdhK (plastid) [Cucurbita ficifolia]) HSP 1 Score: 135.6 bits (340), Expect = 8.5e-29 Identity = 66/72 (91.67%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of Bhi01G001446 vs. NCBI nr
Match: AXR94528.1 (NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Hodgsonia macrocarpa] >AXR94614.1 NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Hodgsonia macrocarpa] >AXR94698.1 NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Hodgsonia macrocarpa] >AXR94783.1 NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 135.2 bits (339), Expect = 1.1e-28 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. NCBI nr
Match: YP_009447539.1 (NADH dehydrogenase subunit K (chloroplast) [Cucurbita moschata] >YP_009505084.1 NADH dehydrogenase subunit K (chloroplast) [Cucurbita pepo] >ALO21760.1 NdhK (plastid) [Cucurbita argyrosperma] >ALO21780.1 NdhK (plastid) [Cucurbita argyrosperma var. palmeri] >ALO21959.1 NdhK (plastid) [Cucurbita cordata] >ALO21981.1 NdhK (plastid) [Cucurbita digitata] >ALO22153.1 NdhK (plastid) [Cucurbita foetidissima] >ALO22255.1 NdhK (plastid) [Cucurbita lundelliana] >ALO22394.1 NdhK (plastid) [Cucurbita moschata] >ALO22473.1 NdhK (plastid) [Cucurbita okeechobeensis] >ALO22476.1 NdhK (plastid) [Cucurbita okeechobeensis subsp. martinezii] >ALO22540.1 NdhK (plastid) [Cucurbita pepo subsp. fraterna] >ALO22668.1 NdhK (plastid) [Cucurbita pepo subsp. ovifera] >ALO22713.1 NdhK (plastid) [Cucurbita pepo var. ozarkana] >ALO22759.1 NdhK (plastid) [Cucurbita pepo subsp. pepo] >ALO22844.1 NdhK (plastid) [Cucurbita pepo var. texana] >ALO22916.1 NdhK (plastid) [Cucurbita pedatifolia] >ATY69955.1 NADH dehydrogenase subunit K (chloroplast) [Cucurbita moschata] >AWX90347.1 NADH dehydrogenase subunit K (chloroplast) [Cucurbita pepo]) HSP 1 Score: 135.2 bits (339), Expect = 1.1e-28 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. NCBI nr
Match: YP_009236284.1 (NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Gynostemma pentaphyllum] >YP_009440161.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma longipes] >YP_009440248.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma 'burmanicum'] >YP_009440335.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma pubescens] >AMF84016.1 NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Gynostemma pentaphyllum] >ANI25189.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma pentaphyllum] >ART64999.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma pentaphyllum] >ATG86927.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma longipes] >ATG87014.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma 'burmanicum'] >ATG87101.1 NADH dehydrogenase subunit K (chloroplast) [Gynostemma pubescens]) HSP 1 Score: 135.2 bits (339), Expect = 1.1e-28 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Bhi01G001446 vs. NCBI nr
Match: YP_009317390.1 (NADH dehydrogenase subunit K (chloroplast) [Coccinia grandis] >AOX48750.1 NADH dehydrogenase subunit K (chloroplast) [Coccinia grandis] >AOX48835.1 NADH dehydrogenase subunit K (chloroplast) [Coccinia grandis]) HSP 1 Score: 135.2 bits (339), Expect = 1.1e-28 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|