Bhi01G001194 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAGTATACCAGCACTTTCCGGCGCCACGATGAACACCTCCTTCCTCCGGAAGCAGCCAGCGACAAGGCTACGTTCGGCATCAAACTTCAGCCAGGGTCTGTTTGGGCTGAAAGGGGGCAGTCGAGGCGGGCGTGTGATTGCCATGGCAGAGTACAATGTGAAGCTGATCACACCAGAAGGAGAGAAGGAGTTCAGCTGCCCGGATGATGAATACATTCTCGATCGTGCAGATGATTTGGGAATTGATCTTCCTTATTCATGTAGGGCAGGGTCTTGTTCTTCTTGTGCAGGGAAAGTAATAGAAGGGAAGGTGGATCAGTCAGATGGCAACTTCCTCGACGACGATCAGGCTGAAGAAGGTTGGGTTCTAACTTGTGTTGCTTACCCTCAGTCAAATGTCGTCATTGAGACCCACAAGGAAGAAGAACTAGTTAGTTAA ATGGCCAGTATACCAGCACTTTCCGGCGCCACGATGAACACCTCCTTCCTCCGGAAGCAGCCAGCGACAAGGCTACGTTCGGCATCAAACTTCAGCCAGGGTCTGTTTGGGCTGAAAGGGGGCAGTCGAGGCGGGCGTGTGATTGCCATGGCAGAGTACAATGTGAAGCTGATCACACCAGAAGGAGAGAAGGAGTTCAGCTGCCCGGATGATGAATACATTCTCGATCGTGCAGATGATTTGGGAATTGATCTTCCTTATTCATGTAGGGCAGGGTCTTGTTCTTCTTGTGCAGGGAAAGTAATAGAAGGGAAGGTGGATCAGTCAGATGGCAACTTCCTCGACGACGATCAGGCTGAAGAAGGTTGGGTTCTAACTTGTGTTGCTTACCCTCAGTCAAATGTCGTCATTGAGACCCACAAGGAAGAAGAACTAGTTAGTTAA ATGGCCAGTATACCAGCACTTTCCGGCGCCACGATGAACACCTCCTTCCTCCGGAAGCAGCCAGCGACAAGGCTACGTTCGGCATCAAACTTCAGCCAGGGTCTGTTTGGGCTGAAAGGGGGCAGTCGAGGCGGGCGTGTGATTGCCATGGCAGAGTACAATGTGAAGCTGATCACACCAGAAGGAGAGAAGGAGTTCAGCTGCCCGGATGATGAATACATTCTCGATCGTGCAGATGATTTGGGAATTGATCTTCCTTATTCATGTAGGGCAGGGTCTTGTTCTTCTTGTGCAGGGAAAGTAATAGAAGGGAAGGTGGATCAGTCAGATGGCAACTTCCTCGACGACGATCAGGCTGAAGAAGGTTGGGTTCTAACTTGTGTTGCTTACCCTCAGTCAAATGTCGTCATTGAGACCCACAAGGAAGAAGAACTAGTTAGTTAA MASIPALSGATMNTSFLRKQPATRLRSASNFSQGLFGLKGGSRGGRVIAMAEYNVKLITPEGEKEFSCPDDEYILDRADDLGIDLPYSCRAGSCSSCAGKVIEGKVDQSDGNFLDDDQAEEGWVLTCVAYPQSNVVIETHKEEELVS
BLAST of Bhi01G001194 vs. TAIR10
Match: AT1G60950.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 184.5 bits (467), Expect = 4.7e-47 Identity = 96/144 (66.67%), Postives = 111/144 (77.08%), Query Frame = 0
BLAST of Bhi01G001194 vs. TAIR10
Match: AT1G10960.1 (ferredoxin 1) HSP 1 Score: 179.5 bits (454), Expect = 1.5e-45 Identity = 90/144 (62.50%), Postives = 110/144 (76.39%), Query Frame = 0
BLAST of Bhi01G001194 vs. TAIR10
Match: AT2G27510.1 (ferredoxin 3) HSP 1 Score: 147.9 bits (372), Expect = 4.9e-36 Identity = 76/149 (51.01%), Postives = 98/149 (65.77%), Query Frame = 0
BLAST of Bhi01G001194 vs. TAIR10
Match: AT5G10000.1 (ferredoxin 4) HSP 1 Score: 115.2 bits (287), Expect = 3.5e-26 Identity = 57/128 (44.53%), Postives = 88/128 (68.75%), Query Frame = 0
BLAST of Bhi01G001194 vs. TAIR10
Match: AT4G14890.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 83.2 bits (204), Expect = 1.5e-16 Identity = 45/103 (43.69%), Postives = 58/103 (56.31%), Query Frame = 0
BLAST of Bhi01G001194 vs. Swiss-Prot
Match: sp|O04683|FER1_MESCR (Ferredoxin-1, chloroplastic OS=Mesembryanthemum crystallinum OX=3544 PE=2 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 1.1e-48 Identity = 93/146 (63.70%), Postives = 109/146 (74.66%), Query Frame = 0
BLAST of Bhi01G001194 vs. Swiss-Prot
Match: sp|P09911|FER1_PEA (Ferredoxin-1, chloroplastic OS=Pisum sativum OX=3888 GN=PETF PE=1 SV=2) HSP 1 Score: 190.7 bits (483), Expect = 1.2e-47 Identity = 94/149 (63.09%), Postives = 114/149 (76.51%), Query Frame = 0
BLAST of Bhi01G001194 vs. Swiss-Prot
Match: sp|Q43517|FER1_SOLLC (Ferredoxin-1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=SEND33 PE=2 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 1.6e-47 Identity = 94/143 (65.73%), Postives = 112/143 (78.32%), Query Frame = 0
BLAST of Bhi01G001194 vs. Swiss-Prot
Match: sp|Q9ZTS2|FER_CAPAN (Ferredoxin, chloroplastic OS=Capsicum annuum OX=4072 GN=AP1 PE=1 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 3.5e-47 Identity = 92/142 (64.79%), Postives = 111/142 (78.17%), Query Frame = 0
BLAST of Bhi01G001194 vs. Swiss-Prot
Match: sp|P16972|FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD2 PE=1 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 8.5e-46 Identity = 96/144 (66.67%), Postives = 111/144 (77.08%), Query Frame = 0
BLAST of Bhi01G001194 vs. TrEMBL
Match: tr|A0A1S3C2F7|A0A1S3C2F7_CUCME (Ferredoxin OS=Cucumis melo OX=3656 GN=LOC103496101 PE=3 SV=1) HSP 1 Score: 244.2 bits (622), Expect = 1.8e-61 Identity = 120/148 (81.08%), Postives = 130/148 (87.84%), Query Frame = 0
BLAST of Bhi01G001194 vs. TrEMBL
Match: tr|A0A0A0LAD3|A0A0A0LAD3_CUCSA (Ferredoxin OS=Cucumis sativus OX=3659 GN=Csa_3G222790 PE=3 SV=1) HSP 1 Score: 238.8 bits (608), Expect = 7.7e-60 Identity = 116/148 (78.38%), Postives = 127/148 (85.81%), Query Frame = 0
BLAST of Bhi01G001194 vs. TrEMBL
Match: tr|A0A200QV92|A0A200QV92_9MAGN (Ferredoxin OS=Macleaya cordata OX=56857 GN=BVC80_8551g11 PE=3 SV=1) HSP 1 Score: 222.6 bits (566), Expect = 5.7e-55 Identity = 105/142 (73.94%), Postives = 121/142 (85.21%), Query Frame = 0
BLAST of Bhi01G001194 vs. TrEMBL
Match: tr|A0A151UBX8|A0A151UBX8_CAJCA (Ferredoxin OS=Cajanus cajan OX=3821 GN=KK1_021070 PE=3 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 6.3e-54 Identity = 108/147 (73.47%), Postives = 124/147 (84.35%), Query Frame = 0
BLAST of Bhi01G001194 vs. TrEMBL
Match: tr|A0A2I4FV54|A0A2I4FV54_9ROSI (Ferredoxin OS=Juglans regia OX=51240 GN=LOC109002301 PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.1e-53 Identity = 104/147 (70.75%), Postives = 123/147 (83.67%), Query Frame = 0
BLAST of Bhi01G001194 vs. NCBI nr
Match: XP_023552303.1 (ferredoxin-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 255.4 bits (651), Expect = 1.2e-64 Identity = 120/147 (81.63%), Postives = 135/147 (91.84%), Query Frame = 0
BLAST of Bhi01G001194 vs. NCBI nr
Match: XP_022136608.1 (ferredoxin [Momordica charantia]) HSP 1 Score: 251.5 bits (641), Expect = 1.7e-63 Identity = 122/147 (82.99%), Postives = 131/147 (89.12%), Query Frame = 0
BLAST of Bhi01G001194 vs. NCBI nr
Match: XP_008456053.1 (PREDICTED: ferredoxin-like [Cucumis melo]) HSP 1 Score: 244.2 bits (622), Expect = 2.8e-61 Identity = 120/148 (81.08%), Postives = 130/148 (87.84%), Query Frame = 0
BLAST of Bhi01G001194 vs. NCBI nr
Match: XP_022984878.1 (ferredoxin-A-like [Cucurbita maxima]) HSP 1 Score: 242.7 bits (618), Expect = 8.1e-61 Identity = 114/147 (77.55%), Postives = 131/147 (89.12%), Query Frame = 0
BLAST of Bhi01G001194 vs. NCBI nr
Match: XP_022922723.1 (ferredoxin-A-like [Cucurbita moschata]) HSP 1 Score: 240.4 bits (612), Expect = 4.0e-60 Identity = 113/147 (76.87%), Postives = 131/147 (89.12%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|