Bhi01G001193 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCAGCACCACCGCATTCACCGCTCCATTTCCGGCCGCTTCCTTCCTCCGCCGGAATCCTGCCGGTGGAGTGAGCCTTAAGCCATTTCCCAACGTGGGTCAGTCTCTGTTTGGGCTGAAGCACGGCAGCAGCCGCGGCGGACGAGTGACGGCGATGGCCTACAACATAACCCTCATAACCCCAGAAGGAGAGAAATCGATTACATGTACTAGTGATGTATACATTTTAGATGCGGCTGAGGAAGCCGGGCTTGACCTTCCTTACTCTTGCAGAGCAGGGGCTTGTTCTTCTTGCGTTGGAAAAGTGGTATCAGGGACATTGGATCAATCTGATAATAGCTTTCTTGATGATGATCAGATGGCTCAAGGTTGGGTTTTAACTTGTGTTGCTAGGCCTGAATCTGATCTTGTAATTGAGACCCACAAGGAGGACGTCTTTGCTGGTTAA ATGGGCAGCACCACCGCATTCACCGCTCCATTTCCGGCCGCTTCCTTCCTCCGCCGGAATCCTGCCGGTGGAGTGAGCCTTAAGCCATTTCCCAACGTGGGTCAGTCTCTGTTTGGGCTGAAGCACGGCAGCAGCCGCGGCGGACGAGTGACGGCGATGGCCTACAACATAACCCTCATAACCCCAGAAGGAGAGAAATCGATTACATGTACTAGTGATGTATACATTTTAGATGCGGCTGAGGAAGCCGGGCTTGACCTTCCTTACTCTTGCAGAGCAGGGGCTTGTTCTTCTTGCGTTGGAAAAGTGGTATCAGGGACATTGGATCAATCTGATAATAGCTTTCTTGATGATGATCAGATGGCTCAAGGTTGGGTTTTAACTTGTGTTGCTAGGCCTGAATCTGATCTTGTAATTGAGACCCACAAGGAGGACGTCTTTGCTGGTTAA ATGGGCAGCACCACCGCATTCACCGCTCCATTTCCGGCCGCTTCCTTCCTCCGCCGGAATCCTGCCGGTGGAGTGAGCCTTAAGCCATTTCCCAACGTGGGTCAGTCTCTGTTTGGGCTGAAGCACGGCAGCAGCCGCGGCGGACGAGTGACGGCGATGGCCTACAACATAACCCTCATAACCCCAGAAGGAGAGAAATCGATTACATGTACTAGTGATGTATACATTTTAGATGCGGCTGAGGAAGCCGGGCTTGACCTTCCTTACTCTTGCAGAGCAGGGGCTTGTTCTTCTTGCGTTGGAAAAGTGGTATCAGGGACATTGGATCAATCTGATAATAGCTTTCTTGATGATGATCAGATGGCTCAAGGTTGGGTTTTAACTTGTGTTGCTAGGCCTGAATCTGATCTTGTAATTGAGACCCACAAGGAGGACGTCTTTGCTGGTTAA MGSTTAFTAPFPAASFLRRNPAGGVSLKPFPNVGQSLFGLKHGSSRGGRVTAMAYNITLITPEGEKSITCTSDVYILDAAEEAGLDLPYSCRAGACSSCVGKVVSGTLDQSDNSFLDDDQMAQGWVLTCVARPESDLVIETHKEDVFAG
BLAST of Bhi01G001193 vs. TAIR10
Match: AT1G10960.1 (ferredoxin 1) HSP 1 Score: 186.8 bits (473), Expect = 9.6e-48 Identity = 95/146 (65.07%), Postives = 117/146 (80.14%), Query Frame = 0
BLAST of Bhi01G001193 vs. TAIR10
Match: AT1G60950.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 186.0 bits (471), Expect = 1.6e-47 Identity = 91/145 (62.76%), Postives = 115/145 (79.31%), Query Frame = 0
BLAST of Bhi01G001193 vs. TAIR10
Match: AT2G27510.1 (ferredoxin 3) HSP 1 Score: 134.4 bits (337), Expect = 5.7e-32 Identity = 63/108 (58.33%), Postives = 79/108 (73.15%), Query Frame = 0
BLAST of Bhi01G001193 vs. TAIR10
Match: AT5G10000.1 (ferredoxin 4) HSP 1 Score: 107.8 bits (268), Expect = 5.7e-24 Identity = 53/109 (48.62%), Postives = 75/109 (68.81%), Query Frame = 0
BLAST of Bhi01G001193 vs. TAIR10
Match: AT4G14890.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 71.6 bits (174), Expect = 4.5e-13 Identity = 36/98 (36.73%), Postives = 53/98 (54.08%), Query Frame = 0
BLAST of Bhi01G001193 vs. Swiss-Prot
Match: sp|O04090|FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD1 PE=1 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 1.7e-46 Identity = 95/146 (65.07%), Postives = 117/146 (80.14%), Query Frame = 0
BLAST of Bhi01G001193 vs. Swiss-Prot
Match: sp|P16972|FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD2 PE=1 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 3.0e-46 Identity = 91/145 (62.76%), Postives = 115/145 (79.31%), Query Frame = 0
BLAST of Bhi01G001193 vs. Swiss-Prot
Match: sp|Q9ZTS2|FER_CAPAN (Ferredoxin, chloroplastic OS=Capsicum annuum OX=4072 GN=AP1 PE=1 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.2e-42 Identity = 86/143 (60.14%), Postives = 105/143 (73.43%), Query Frame = 0
BLAST of Bhi01G001193 vs. Swiss-Prot
Match: sp|O04683|FER1_MESCR (Ferredoxin-1, chloroplastic OS=Mesembryanthemum crystallinum OX=3544 PE=2 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 7.6e-42 Identity = 85/144 (59.03%), Postives = 108/144 (75.00%), Query Frame = 0
BLAST of Bhi01G001193 vs. Swiss-Prot
Match: sp|Q43517|FER1_SOLLC (Ferredoxin-1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=SEND33 PE=2 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 1.2e-39 Identity = 84/134 (62.69%), Postives = 99/134 (73.88%), Query Frame = 0
BLAST of Bhi01G001193 vs. TrEMBL
Match: tr|A0A1S3C1X0|A0A1S3C1X0_CUCME (Ferredoxin OS=Cucumis melo OX=3656 GN=LOC103496100 PE=3 SV=1) HSP 1 Score: 264.6 bits (675), Expect = 1.3e-67 Identity = 127/149 (85.23%), Postives = 136/149 (91.28%), Query Frame = 0
BLAST of Bhi01G001193 vs. TrEMBL
Match: tr|A0A0A0L764|A0A0A0L764_CUCSA (Ferredoxin OS=Cucumis sativus OX=3659 GN=Csa_3G222800 PE=3 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 8.3e-62 Identity = 115/149 (77.18%), Postives = 131/149 (87.92%), Query Frame = 0
BLAST of Bhi01G001193 vs. TrEMBL
Match: tr|A0A2P5BHJ1|A0A2P5BHJ1_9ROSA (Ferredoxin OS=Trema orientalis OX=63057 GN=TorRG33x02_320950 PE=3 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 1.3e-46 Identity = 96/147 (65.31%), Postives = 113/147 (76.87%), Query Frame = 0
BLAST of Bhi01G001193 vs. TrEMBL
Match: tr|A0A2P5BC06|A0A2P5BC06_PARAD (Ferredoxin OS=Parasponia andersonii OX=3476 GN=PanWU01x14_252590 PE=3 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 2.2e-46 Identity = 96/147 (65.31%), Postives = 113/147 (76.87%), Query Frame = 0
BLAST of Bhi01G001193 vs. TrEMBL
Match: tr|A0A1J3F2J5|A0A1J3F2J5_NOCCA (Ferredoxin OS=Noccaea caerulescens OX=107243 GN=LC_TR1212_c3_g1_i1_g.3322 PE=3 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 1.9e-45 Identity = 96/148 (64.86%), Postives = 118/148 (79.73%), Query Frame = 0
BLAST of Bhi01G001193 vs. NCBI nr
Match: XP_008456052.1 (PREDICTED: ferredoxin-like [Cucumis melo]) HSP 1 Score: 264.6 bits (675), Expect = 2.0e-67 Identity = 127/149 (85.23%), Postives = 136/149 (91.28%), Query Frame = 0
BLAST of Bhi01G001193 vs. NCBI nr
Match: XP_004146259.1 (PREDICTED: ferredoxin, leaf L-A-like [Cucumis sativus] >KGN57598.1 hypothetical protein Csa_3G222800 [Cucumis sativus]) HSP 1 Score: 245.4 bits (625), Expect = 1.3e-61 Identity = 115/149 (77.18%), Postives = 131/149 (87.92%), Query Frame = 0
BLAST of Bhi01G001193 vs. NCBI nr
Match: XP_022941964.1 (ferredoxin-like [Cucurbita moschata] >XP_022983176.1 ferredoxin-like [Cucurbita maxima] >XP_023547581.1 ferredoxin-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 240.0 bits (611), Expect = 5.3e-60 Identity = 116/149 (77.85%), Postives = 127/149 (85.23%), Query Frame = 0
BLAST of Bhi01G001193 vs. NCBI nr
Match: XP_022136604.1 (ferredoxin-like [Momordica charantia]) HSP 1 Score: 231.1 bits (588), Expect = 2.5e-57 Identity = 114/149 (76.51%), Postives = 125/149 (83.89%), Query Frame = 0
BLAST of Bhi01G001193 vs. NCBI nr
Match: XP_022136608.1 (ferredoxin [Momordica charantia]) HSP 1 Score: 201.1 bits (510), Expect = 2.7e-48 Identity = 100/146 (68.49%), Postives = 115/146 (78.77%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|