Bhi01G000760 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCTTCGTACAATACCAAAGTATATTGTAGACAGACTTTGGTTGGTGGATTTTATGGTGTTCTCTTACCCCATACTTTAGCCCCTTCGCCAGATTACTATGGGTAAGGCCCATAACATAATTTCTCATTTTTTTTTTCCAAAGTAGGGTGTTTAACTCAAAGAGCTTGAGTAGGAGAGTGGAGTTGTGAAATATAGGTCTCACGATTAAAAAAGAAAAATCAATCTTATGTTGGCTCCTGCGACTTCATAACTCTTCAATTTTACGATTCCAATATTTGTCCTAAACACTCGTGAAAGTATTTTTCTAATTTGGTGTATTTTGTTTATTTTTTTAGGGCACTTCTCTTTCACCAACTTATGGGTCCTGGTGTTCTCAAAGTTGACAATAATGTCTCTTCCTATTTGCGTACTTATGCTCATTGCACCAAAGGAAGAGTAAGAAGTTGATTGATTGTTATTTTTTAGTAACATTTTGAATATATTGATTAGATTTATTACCATATTGAACTAAATTGATCATTTTATATTGTAGACTGGTGTAAGCATGCTATTCATTAATCTAAGCAACCAAACAGAGTTCACAATTGAGATTGAAAAGAACATGAACATGAGGTTGCCTAACAAGCCAGTTCAAAGGGAGGAATATCATTTAACTCCAACTAATGGCTTACTTAGAAGTTCCACG ATGGCTGCTTCGTACAATACCAAAGTATATTGTAGACAGACTTTGGTTGGTGGATTTTATGGTGTTCTCTTACCCCATACTTTAGCCCCTTCGCCAGATTACTATGGGGCACTTCTCTTTCACCAACTTATGGGTCCTGGTGTTCTCAAAGTTGACAATAATGTCTCTTCCTATTTGCGTACTTATGCTCATTGCACCAAAGGAAGAACTGGTGTAAGCATGCTATTCATTAATCTAAGCAACCAAACAGAGTTCACAATTGAGATTGAAAAGAACATGAACATGAGGTTGCCTAACAAGCCAGTTCAAAGGGAGGAATATCATTTAACTCCAACTAATGGCTTACTTAGAAGTTCCACG ATGGCTGCTTCGTACAATACCAAAGTATATTGTAGACAGACTTTGGTTGGTGGATTTTATGGTGTTCTCTTACCCCATACTTTAGCCCCTTCGCCAGATTACTATGGGGCACTTCTCTTTCACCAACTTATGGGTCCTGGTGTTCTCAAAGTTGACAATAATGTCTCTTCCTATTTGCGTACTTATGCTCATTGCACCAAAGGAAGAACTGGTGTAAGCATGCTATTCATTAATCTAAGCAACCAAACAGAGTTCACAATTGAGATTGAAAAGAACATGAACATGAGGTTGCCTAACAAGCCAGTTCAAAGGGAGGAATATCATTTAACTCCAACTAATGGCTTACTTAGAAGTTCCACG MAASYNTKVYCRQTLVGGFYGVLLPHTLAPSPDYYGALLFHQLMGPGVLKVDNNVSSYLRTYAHCTKGRTGVSMLFINLSNQTEFTIEIEKNMNMRLPNKPVQREEYHLTPTNGLLRSST
BLAST of Bhi01G000760 vs. TAIR10
Match: AT5G07830.1 (glucuronidase 2) HSP 1 Score: 142.1 bits (357), Expect = 2.2e-34 Identity = 73/145 (50.34%), Postives = 92/145 (63.45%), Query Frame = 0
BLAST of Bhi01G000760 vs. TAIR10
Match: AT5G61250.2 (glucuronidase 1) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-29 Identity = 64/143 (44.76%), Postives = 84/143 (58.74%), Query Frame = 0
BLAST of Bhi01G000760 vs. TAIR10
Match: AT5G34940.2 (glucuronidase 3) HSP 1 Score: 104.4 bits (259), Expect = 5.1e-23 Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 0
BLAST of Bhi01G000760 vs. Swiss-Prot
Match: sp|Q9FF10|HPSE1_ARATH (Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 4.0e-33 Identity = 73/145 (50.34%), Postives = 92/145 (63.45%), Query Frame = 0
BLAST of Bhi01G000760 vs. Swiss-Prot
Match: sp|Q8L608|HPSE2_ARATH (Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.8e-28 Identity = 64/143 (44.76%), Postives = 84/143 (58.74%), Query Frame = 0
BLAST of Bhi01G000760 vs. Swiss-Prot
Match: sp|Q9FZP1|HPSE3_ARATH (Heparanase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g34940 PE=2 SV=2) HSP 1 Score: 104.4 bits (259), Expect = 9.1e-22 Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 0
BLAST of Bhi01G000760 vs. Swiss-Prot
Match: sp|Q9LRC8|BAGLU_SCUBA (Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.8e-20 Identity = 52/118 (44.07%), Postives = 72/118 (61.02%), Query Frame = 0
BLAST of Bhi01G000760 vs. Swiss-Prot
Match: sp|X4Y2L4|LHYAL_HIRNI (Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.8e-09 Identity = 38/121 (31.40%), Postives = 68/121 (56.20%), Query Frame = 0
BLAST of Bhi01G000760 vs. TrEMBL
Match: tr|A0A1S3AY64|A0A1S3AY64_CUCME (heparanase-like protein 2 OS=Cucumis melo OX=3656 GN=LOC103483878 PE=4 SV=1) HSP 1 Score: 215.3 bits (547), Expect = 7.4e-53 Identity = 104/121 (85.95%), Postives = 112/121 (92.56%), Query Frame = 0
BLAST of Bhi01G000760 vs. TrEMBL
Match: tr|A0A0A0L5V7|A0A0A0L5V7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G165650 PE=4 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 1.7e-49 Identity = 98/121 (80.99%), Postives = 109/121 (90.08%), Query Frame = 0
BLAST of Bhi01G000760 vs. TrEMBL
Match: tr|A0A0A0KTJ9|A0A0A0KTJ9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G390000 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 2.0e-45 Identity = 95/130 (73.08%), Postives = 104/130 (80.00%), Query Frame = 0
BLAST of Bhi01G000760 vs. TrEMBL
Match: tr|A0A1S3BWF5|A0A1S3BWF5_CUCME (heparanase-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103494371 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.9e-40 Identity = 88/134 (65.67%), Postives = 101/134 (75.37%), Query Frame = 0
BLAST of Bhi01G000760 vs. TrEMBL
Match: tr|A0A0A0KUF1|A0A0A0KUF1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G043860 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 3.2e-40 Identity = 86/132 (65.15%), Postives = 98/132 (74.24%), Query Frame = 0
BLAST of Bhi01G000760 vs. NCBI nr
Match: XP_008438923.1 (PREDICTED: heparanase-like protein 2 [Cucumis melo]) HSP 1 Score: 215.3 bits (547), Expect = 1.1e-52 Identity = 104/121 (85.95%), Postives = 112/121 (92.56%), Query Frame = 0
BLAST of Bhi01G000760 vs. NCBI nr
Match: XP_004134497.1 (PREDICTED: heparanase-like protein 2 isoform X2 [Cucumis sativus] >KGN57148.1 hypothetical protein Csa_3G165650 [Cucumis sativus]) HSP 1 Score: 204.1 bits (518), Expect = 2.6e-49 Identity = 98/121 (80.99%), Postives = 109/121 (90.08%), Query Frame = 0
BLAST of Bhi01G000760 vs. NCBI nr
Match: XP_011651069.1 (PREDICTED: heparanase-like protein 2 isoform X1 [Cucumis sativus]) HSP 1 Score: 204.1 bits (518), Expect = 2.6e-49 Identity = 98/121 (80.99%), Postives = 109/121 (90.08%), Query Frame = 0
BLAST of Bhi01G000760 vs. NCBI nr
Match: XP_022137762.1 (heparanase-like protein 1 [Momordica charantia]) HSP 1 Score: 192.2 bits (487), Expect = 1.0e-45 Identity = 90/121 (74.38%), Postives = 106/121 (87.60%), Query Frame = 0
BLAST of Bhi01G000760 vs. NCBI nr
Match: XP_022979750.1 (heparanase-like protein 1 isoform X1 [Cucurbita maxima]) HSP 1 Score: 191.8 bits (486), Expect = 1.3e-45 Identity = 94/137 (68.61%), Postives = 106/137 (77.37%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |