Bhi01G000334 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GCATACGTAGATTCAAAGACGTTAACAGAGAAAGAGTTGCTTAAATTTGGTGAGAGCAAGGAATCGGAGGGGTTGGAAGTGGTTACGTTGGTGTGTGGCCTAATCTCCGGCGAGTCTCCTCATCGGCCTTCTCCAGCCTTAACCACCATTATCACATTCTCTCAGTTTATCGATGAAAGTGAACCCTTCAAACTCCTCAGATATCTGGAAGAGTTGGATGGTAAAGTCCCACTAGTCCACATTGATGATGTTTGTGATGCACACATTTTCTGTATGGAACAATCTTCAATCCATGGCAGATTCCTGTGTGCAACTTCTTTCTTGTCTTCTTCAGATATTGCCAATTGCTACCGTCTTCACCATCCTCAATTGCAACAAAAACACGG GCATACGTAGATTCAAAGACGTTAACAGAGAAAGAGTTGCTTAAATTTGGTGAGAGCAAGGAATCGGAGGGGTTGGAAGTGGTTACGTTGGTGTGTGGCCTAATCTCCGGCGAGTCTCCTCATCGGCCTTCTCCAGCCTTAACCACCATTATCACATTCTCTCAGTTTATCGATGAAAGTGAACCCTTCAAACTCCTCAGATATCTGGAAGAGTTGGATGGTAAAGTCCCACTAGTCCACATTGATGATGTTTGTGATGCACACATTTTCTGTATGGAACAATCTTCAATCCATGGCAGATTCCTGTGTGCAACTTCTTTCTTGTCTTCTTCAGATATTGCCAATTGCTACCGTCTTCACCATCCTCAATTGCAACAAAAACACGG GCATACGTAGATTCAAAGACGTTAACAGAGAAAGAGTTGCTTAAATTTGGTGAGAGCAAGGAATCGGAGGGGTTGGAAGTGGTTACGTTGGTGTGTGGCCTAATCTCCGGCGAGTCTCCTCATCGGCCTTCTCCAGCCTTAACCACCATTATCACATTCTCTCAGTTTATCGATGAAAGTGAACCCTTCAAACTCCTCAGATATCTGGAAGAGTTGGATGGTAAAGTCCCACTAGTCCACATTGATGATGTTTGTGATGCACACATTTTCTGTATGGAACAATCTTCAATCCATGGCAGATTCCTGTGTGCAACTTCTTTCTTGTCTTCTTCAGATATTGCCAATTGCTACCGTCTTCACCATCCTCAATTGCAACAAAAACACGG AYVDSKTLTEKELLKFGESKESEGLEVVTLVCGLISGESPHRPSPALTTIITFSQFIDESEPFKLLRYLEELDGKVPLVHIDDVCDAHIFCMEQSSIHGRFLCATSFLSSSDIANCYRLHHPQLQQKH
BLAST of Bhi01G000334 vs. TAIR10
Match: AT4G27250.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-10 Identity = 35/122 (28.69%), Postives = 67/122 (54.92%), Query Frame = 0
BLAST of Bhi01G000334 vs. TAIR10
Match: AT1G61720.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 4.9e-08 Identity = 35/122 (28.69%), Postives = 65/122 (53.28%), Query Frame = 0
BLAST of Bhi01G000334 vs. TAIR10
Match: AT5G42800.1 (dihydroflavonol 4-reductase) HSP 1 Score: 53.9 bits (128), Expect = 8.4e-08 Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 0
BLAST of Bhi01G000334 vs. TAIR10
Match: AT2G45400.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 52.4 bits (124), Expect = 2.4e-07 Identity = 42/126 (33.33%), Postives = 61/126 (48.41%), Query Frame = 0
BLAST of Bhi01G000334 vs. TAIR10
Match: AT1G68540.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 7.8e-06 Identity = 35/122 (28.69%), Postives = 56/122 (45.90%), Query Frame = 0
BLAST of Bhi01G000334 vs. Swiss-Prot
Match: sp|Q5XLY0|ANR_GINBI (Putative anthocyanidin reductase OS=Ginkgo biloba OX=3311 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.8e-10 Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 0
BLAST of Bhi01G000334 vs. Swiss-Prot
Match: sp|Q7PCC4|ANRCH_VITVI (Anthocyanidin reductase ((2S)-flavan-3-ol-forming) OS=Vitis vinifera OX=29760 GN=ANR PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.0e-10 Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 0
BLAST of Bhi01G000334 vs. Swiss-Prot
Match: sp|Q5FB34|ANRCS_VITVI (Anthocyanidin reductase ((2S)-flavan-3-ol-forming) OS=Vitis vinifera OX=29760 GN=ANR PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.6e-10 Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 0
BLAST of Bhi01G000334 vs. Swiss-Prot
Match: sp|D7U6G6|ANRPN_VITVI (Anthocyanidin reductase ((2S)-flavan-3-ol-forming) OS=Vitis vinifera OX=29760 GN=ANR PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.6e-10 Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 0
BLAST of Bhi01G000334 vs. Swiss-Prot
Match: sp|P51108|DFRA_MAIZE (Dihydroflavonol 4-reductase OS=Zea mays OX=4577 GN=A1 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.8e-07 Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 0
BLAST of Bhi01G000334 vs. TrEMBL
Match: tr|A0A0A0L371|A0A0A0L371_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G119707 PE=4 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 6.1e-53 Identity = 102/127 (80.31%), Postives = 119/127 (93.70%), Query Frame = 0
BLAST of Bhi01G000334 vs. TrEMBL
Match: tr|A0A1S3AUS8|A0A1S3AUS8_CUCME (vestitone reductase-like OS=Cucumis melo OX=3656 GN=LOC103483203 PE=4 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 105/127 (82.68%), Postives = 114/127 (89.76%), Query Frame = 0
BLAST of Bhi01G000334 vs. TrEMBL
Match: tr|A0A0A0L5Y5|A0A0A0L5Y5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G119705 PE=4 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 102/127 (80.31%), Postives = 117/127 (92.13%), Query Frame = 0
BLAST of Bhi01G000334 vs. TrEMBL
Match: tr|A0A0A0L3X0|A0A0A0L3X0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G119702 PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 9.1e-49 Identity = 103/137 (75.18%), Postives = 113/137 (82.48%), Query Frame = 0
BLAST of Bhi01G000334 vs. TrEMBL
Match: tr|A0A1S4DSH8|A0A1S4DSH8_CUCME (vestitone reductase-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103483205 PE=3 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 3.3e-43 Identity = 95/130 (73.08%), Postives = 110/130 (84.62%), Query Frame = 0
BLAST of Bhi01G000334 vs. NCBI nr
Match: XP_004134310.2 (PREDICTED: vestitone reductase-like [Cucumis sativus] >KGN56440.1 hypothetical protein Csa_3G119707 [Cucumis sativus]) HSP 1 Score: 215.7 bits (548), Expect = 9.2e-53 Identity = 102/127 (80.31%), Postives = 119/127 (93.70%), Query Frame = 0
BLAST of Bhi01G000334 vs. NCBI nr
Match: XP_008437918.1 (PREDICTED: vestitone reductase-like [Cucumis melo]) HSP 1 Score: 213.4 bits (542), Expect = 4.6e-52 Identity = 105/127 (82.68%), Postives = 114/127 (89.76%), Query Frame = 0
BLAST of Bhi01G000334 vs. NCBI nr
Match: KGN56439.1 (hypothetical protein Csa_3G119705 [Cucumis sativus]) HSP 1 Score: 213.4 bits (542), Expect = 4.6e-52 Identity = 102/127 (80.31%), Postives = 117/127 (92.13%), Query Frame = 0
BLAST of Bhi01G000334 vs. NCBI nr
Match: XP_011650696.1 (PREDICTED: vestitone reductase [Cucumis sativus]) HSP 1 Score: 213.4 bits (542), Expect = 4.6e-52 Identity = 102/127 (80.31%), Postives = 117/127 (92.13%), Query Frame = 0
BLAST of Bhi01G000334 vs. NCBI nr
Match: XP_011650698.1 (PREDICTED: vestitone reductase [Cucumis sativus]) HSP 1 Score: 204.5 bits (519), Expect = 2.1e-49 Identity = 100/127 (78.74%), Postives = 114/127 (89.76%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |