Bhi01G000215 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTAACAGGGAAGCCATGCTAGCATTAGGAAAAAATGGAGTGATAATCAACATTGGTCGCGGTGCAGTCATCGACAAGAAGGAGATGATTCGATGTCTGGTTGATGGGGAGATTGGGGGTGCTGGACTGGATGTGTTTGAGATCGAACCCGATATTCCAAAACAGCTCTTTACACTTGATAATGTTGTGTTGTCACCGCATGCTGCTATCACAACACATGAATCATTTGTGGGAATGTCTAAGTTGGTGGTGGAAAACTTGGAGGCATTCTTCTCAAACAAACCTTTGATGTCTCCCTATATGGATTATTAG ATGATTAACAGGGAAGCCATGCTAGCATTAGGAAAAAATGGAGTGATAATCAACATTGGTCGCGGTGCAGTCATCGACAAGAAGGAGATGATTCGATGTCTGGTTGATGGGGAGATTGGGGGTGCTGGACTGGATGTGTTTGAGATCGAACCCGATATTCCAAAACAGCTCTTTACACTTGATAATGTTGTGTTGTCACCGCATGCTGCTATCACAACACATGAATCATTTGTGGGAATGTCTAAGTTGGTGGTGGAAAACTTGGAGGCATTCTTCTCAAACAAACCTTTGATGTCTCCCTATATGGATTATTAG ATGATTAACAGGGAAGCCATGCTAGCATTAGGAAAAAATGGAGTGATAATCAACATTGGTCGCGGTGCAGTCATCGACAAGAAGGAGATGATTCGATGTCTGGTTGATGGGGAGATTGGGGGTGCTGGACTGGATGTGTTTGAGATCGAACCCGATATTCCAAAACAGCTCTTTACACTTGATAATGTTGTGTTGTCACCGCATGCTGCTATCACAACACATGAATCATTTGTGGGAATGTCTAAGTTGGTGGTGGAAAACTTGGAGGCATTCTTCTCAAACAAACCTTTGATGTCTCCCTATATGGATTATTAG MINREAMLALGKNGVIINIGRGAVIDKKEMIRCLVDGEIGGAGLDVFEIEPDIPKQLFTLDNVVLSPHAAITTHESFVGMSKLVVENLEAFFSNKPLMSPYMDY
BLAST of Bhi01G000215 vs. TAIR10
Match: AT2G45630.2 (D-isomer specific 2-hydroxyacid dehydrogenase family protein) HSP 1 Score: 139.4 bits (350), Expect = 1.2e-33 Identity = 63/102 (61.76%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of Bhi01G000215 vs. TAIR10
Match: AT1G12550.1 (D-isomer specific 2-hydroxyacid dehydrogenase family protein) HSP 1 Score: 136.0 bits (341), Expect = 1.4e-32 Identity = 62/100 (62.00%), Postives = 83/100 (83.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. TAIR10
Match: AT1G79870.1 (D-isomer specific 2-hydroxyacid dehydrogenase family protein) HSP 1 Score: 109.0 bits (271), Expect = 1.8e-24 Identity = 53/100 (53.00%), Postives = 73/100 (73.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. TAIR10
Match: AT5G28310.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 75.5 bits (184), Expect = 2.2e-14 Identity = 39/90 (43.33%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. TAIR10
Match: AT3G19480.1 (D-3-phosphoglycerate dehydrogenase) HSP 1 Score: 55.5 bits (132), Expect = 2.3e-08 Identity = 31/84 (36.90%), Postives = 48/84 (57.14%), Query Frame = 0
BLAST of Bhi01G000215 vs. Swiss-Prot
Match: sp|Q9LE33|HPR3_ARATH (Glyoxylate/hydroxypyruvate reductase HPR3 OS=Arabidopsis thaliana OX=3702 GN=HPR3 PE=2 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.5e-31 Identity = 62/100 (62.00%), Postives = 83/100 (83.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. Swiss-Prot
Match: sp|Q65CJ7|HPPR_PLESU (Hydroxyphenylpyruvate reductase OS=Plectranthus scutellarioides OX=4142 GN=HPPR PE=1 SV=2) HSP 1 Score: 115.5 bits (288), Expect = 3.4e-25 Identity = 57/100 (57.00%), Postives = 75/100 (75.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. Swiss-Prot
Match: sp|Q9CA90|HPR2_ARATH (Glyoxylate/hydroxypyruvate reductase A HPR2 OS=Arabidopsis thaliana OX=3702 GN=HPR2 PE=1 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.2e-23 Identity = 53/100 (53.00%), Postives = 73/100 (73.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. Swiss-Prot
Match: sp|Q9UYR1|GYAR_PYRAB (Glyoxylate reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=gyaR PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 4.1e-18 Identity = 46/91 (50.55%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of Bhi01G000215 vs. Swiss-Prot
Match: sp|Q5FTU6|2KGR_GLUOX (2-ketogluconate reductase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=GOX0417 PE=1 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.3e-18 Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. TrEMBL
Match: tr|A0A1S3AYM4|A0A1S3AYM4_CUCME (glyoxylate/hydroxypyruvate reductase HPR3-like OS=Cucumis melo OX=3656 GN=LOC103484170 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 1.6e-43 Identity = 89/102 (87.25%), Postives = 98/102 (96.08%), Query Frame = 0
BLAST of Bhi01G000215 vs. TrEMBL
Match: tr|A0A0A0L908|A0A0A0L908_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G124900 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 3.5e-43 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 0
BLAST of Bhi01G000215 vs. TrEMBL
Match: tr|A0A2C9VT46|A0A2C9VT46_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_05G042600 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 5.0e-37 Identity = 76/103 (73.79%), Postives = 90/103 (87.38%), Query Frame = 0
BLAST of Bhi01G000215 vs. TrEMBL
Match: tr|A0A0A0L7K6|A0A0A0L7K6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G124910 PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 6.5e-37 Identity = 77/103 (74.76%), Postives = 92/103 (89.32%), Query Frame = 0
BLAST of Bhi01G000215 vs. TrEMBL
Match: tr|A0A1S3AW95|A0A1S3AW95_CUCME (glyoxylate/hydroxypyruvate reductase HPR3-like OS=Cucumis melo OX=3656 GN=LOC103483323 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 1.1e-36 Identity = 77/103 (74.76%), Postives = 91/103 (88.35%), Query Frame = 0
BLAST of Bhi01G000215 vs. NCBI nr
Match: XP_008439355.1 (PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis melo]) HSP 1 Score: 184.1 bits (466), Expect = 2.4e-43 Identity = 89/102 (87.25%), Postives = 98/102 (96.08%), Query Frame = 0
BLAST of Bhi01G000215 vs. NCBI nr
Match: XP_004134340.1 (PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Cucumis sativus] >KGN56571.1 hypothetical protein Csa_3G124900 [Cucumis sativus]) HSP 1 Score: 183.0 bits (463), Expect = 5.4e-43 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 0
BLAST of Bhi01G000215 vs. NCBI nr
Match: XP_022147257.1 (glyoxylate/hydroxypyruvate reductase HPR3-like [Momordica charantia]) HSP 1 Score: 166.8 bits (421), Expect = 4.0e-38 Identity = 78/100 (78.00%), Postives = 94/100 (94.00%), Query Frame = 0
BLAST of Bhi01G000215 vs. NCBI nr
Match: XP_022159358.1 (glyoxylate/hydroxypyruvate reductase HPR3-like [Momordica charantia]) HSP 1 Score: 164.1 bits (414), Expect = 2.6e-37 Identity = 76/103 (73.79%), Postives = 93/103 (90.29%), Query Frame = 0
BLAST of Bhi01G000215 vs. NCBI nr
Match: XP_021611799.1 (glyoxylate/hydroxypyruvate reductase HPR3-like [Manihot esculenta] >OAY49271.1 hypothetical protein MANES_05G042600 [Manihot esculenta]) HSP 1 Score: 162.5 bits (410), Expect = 7.5e-37 Identity = 76/103 (73.79%), Postives = 90/103 (87.38%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |