Sgr026049.1 (mRNA) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGCGTCAGAGGGACGAGTCATCCGCTGCAACACCATTGATGCATGGAACCAGCAAATACAGAAAGGCAATGGCTCTCAGGAACTGGTAAAACGAATTCAATTTCCATTTAAGAACATTTTTGTTTTTGTTCAATGCTCCTCATTCCTACATCTTTTCGGTTGAAGAGCTGTTTGAATTCTGAGATGAATAATGGAGGAGCTTTGTGTTTGGCATTACTTGATTTGATCGGCAATCTGTTGTTTGATTTCAATGCATCTCGATTCATCCTGTCAAACTCATAGACTTGAAAGACGTGTGGTATTTCAAAAGGATATTGATGCTCGAGAAACTTTTTCATCCTTTTTCTTTGCTTTTGTGGTAGAAAAAGTAATCAAAGTGTGAAATGTTCCGAATCTTTTGTGCTTCCTTTTCTTTAATGAACAATCAATATCATTTTTGTCTCCCACTTGTTGCTTTCCAGAGCAAAGAAATTGGATACATCTGTAGAATATATTAGCATTGAGCTGATTATACGAAGCCAATCCAATCCACATGATTAAATTTTATCACCATGTACCAATGGGAAGCAATCATTTTCTCACGAGAATAGAAGCAATTTCCATGTAGTAGGGAATACCAATTATTGAGTTTTTGACATTTGAACTCATTGTACGTTTCATATAGTTGAATTTTGTTCATGAGTGCTAAAAGAAAACTGATGCAGATAGTTGTGGATTTCACTGCATCATGGTGCGGCCCATGTCGGTTCATTGCACCCTTTCTAGACGAGCTTGCTCAGAAATTTCCCAGTGTCACATTTCTCAAGGTCGATGTGGATGATCTGGAGGTAACTATAAATGAATTCCTCTCTCGCTTCTCTGTGTTGTGTGTGGCTGTGTTAAAAAGGTGTTGGTTGGTGCAGTCGGTAGCTAAAGATTGGGGGGTGGAGGCGATGCCCACTTTCATGTTCCTGAAAGAGGGAAGAATTGTGGACAAGGTGGTGGGAGCTAAGAAGGAAGAACTGCAGCAGACTGTATTCAAGCACATGGCTACTGCTTCTGCCTGA ATGGCAGCGTCAGAGGGACGAGTCATCCGCTGCAACACCATTGATGCATGGAACCAGCAAATACAGAAAGGCAATGGCTCTCAGGAACTGATAGTTGTGGATTTCACTGCATCATGGTGCGGCCCATGTCGGTTCATTGCACCCTTTCTAGACGAGCTTGCTCAGAAATTTCCCAGTGTCACATTTCTCAAGGTCGATGTGGATGATCTGGAGTCGGTAGCTAAAGATTGGGGGGTGGAGGCGATGCCCACTTTCATGTTCCTGAAAGAGGGAAGAATTGTGGACAAGGTGGTGGGAGCTAAGAAGGAAGAACTGCAGCAGACTGTATTCAAGCACATGGCTACTGCTTCTGCCTGA ATGGCAGCGTCAGAGGGACGAGTCATCCGCTGCAACACCATTGATGCATGGAACCAGCAAATACAGAAAGGCAATGGCTCTCAGGAACTGATAGTTGTGGATTTCACTGCATCATGGTGCGGCCCATGTCGGTTCATTGCACCCTTTCTAGACGAGCTTGCTCAGAAATTTCCCAGTGTCACATTTCTCAAGGTCGATGTGGATGATCTGGAGTCGGTAGCTAAAGATTGGGGGGTGGAGGCGATGCCCACTTTCATGTTCCTGAAAGAGGGAAGAATTGTGGACAAGGTGGTGGGAGCTAAGAAGGAAGAACTGCAGCAGACTGTATTCAAGCACATGGCTACTGCTTCTGCCTGA MAASEGRVIRCNTIDAWNQQIQKGNGSQELIVVDFTASWCGPCRFIAPFLDELAQKFPSVTFLKVDVDDLESVAKDWGVEAMPTFMFLKEGRIVDKVVGAKKEELQQTVFKHMATASA Homology
BLAST of Sgr026049.1 vs. NCBI nr
Match: XP_022132467.1 (thioredoxin H-type [Momordica charantia]) HSP 1 Score: 231.1 bits (588), Expect = 4.9e-57 Identity = 110/118 (93.22%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. NCBI nr
Match: KAG6603933.1 (hypothetical protein SDJN03_04542, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034113.1 hypothetical protein SDJN02_03840, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 231.1 bits (588), Expect = 4.9e-57 Identity = 110/118 (93.22%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. NCBI nr
Match: XP_022977568.1 (thioredoxin H-type [Cucurbita maxima]) HSP 1 Score: 231.1 bits (588), Expect = 4.9e-57 Identity = 110/118 (93.22%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. NCBI nr
Match: XP_022950147.1 (thioredoxin H-type-like [Cucurbita moschata]) HSP 1 Score: 229.9 bits (585), Expect = 1.1e-56 Identity = 109/118 (92.37%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. NCBI nr
Match: XP_023543830.1 (thioredoxin H-type-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 229.2 bits (583), Expect = 1.9e-56 Identity = 109/118 (92.37%), Postives = 112/118 (94.92%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy Swiss-Prot
Match: Q43636 (Thioredoxin H-type OS=Ricinus communis OX=3988 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 1.8e-49 Identity = 89/117 (76.07%), Postives = 108/117 (92.31%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy Swiss-Prot
Match: P29448 (Thioredoxin H1 OS=Arabidopsis thaliana OX=3702 GN=TRX1 PE=1 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 1.0e-44 Identity = 78/114 (68.42%), Postives = 99/114 (86.84%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy Swiss-Prot
Match: Q07090 (Thioredoxin H-type 2 OS=Nicotiana tabacum OX=4097 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 3.8e-44 Identity = 82/115 (71.30%), Postives = 100/115 (86.96%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy Swiss-Prot
Match: P29449 (Thioredoxin H-type 1 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 8.2e-39 Identity = 69/116 (59.48%), Postives = 96/116 (82.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy Swiss-Prot
Match: Q39239 (Thioredoxin H4 OS=Arabidopsis thaliana OX=3702 GN=TRX4 PE=1 SV=2) HSP 1 Score: 150.2 bits (378), Expect = 1.5e-35 Identity = 70/119 (58.82%), Postives = 89/119 (74.79%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy TrEMBL
Match: A0A6J1IQD5 (thioredoxin H-type OS=Cucurbita maxima OX=3661 GN=LOC111477862 PE=4 SV=1) HSP 1 Score: 231.1 bits (588), Expect = 2.4e-57 Identity = 110/118 (93.22%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy TrEMBL
Match: A0A6J1BTW6 (thioredoxin H-type OS=Momordica charantia OX=3673 GN=LOC111005317 PE=4 SV=1) HSP 1 Score: 231.1 bits (588), Expect = 2.4e-57 Identity = 110/118 (93.22%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy TrEMBL
Match: A0A6J1GE02 (thioredoxin H-type-like OS=Cucurbita moschata OX=3662 GN=LOC111453323 PE=4 SV=1) HSP 1 Score: 229.9 bits (585), Expect = 5.3e-57 Identity = 109/118 (92.37%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy TrEMBL
Match: A0A6J1HER7 (thioredoxin H-type OS=Cucurbita moschata OX=3662 GN=LOC111463317 PE=4 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 3.8e-55 Identity = 108/118 (91.53%), Postives = 115/118 (97.46%), Query Frame = 0
BLAST of Sgr026049.1 vs. ExPASy TrEMBL
Match: A0A6J1KSA6 (thioredoxin H-type-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111496792 PE=4 SV=1) HSP 1 Score: 221.1 bits (562), Expect = 2.5e-54 Identity = 107/118 (90.68%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of Sgr026049.1 vs. TAIR 10
Match: AT3G51030.1 (thioredoxin H-type 1 ) HSP 1 Score: 180.6 bits (457), Expect = 7.1e-46 Identity = 78/114 (68.42%), Postives = 99/114 (86.84%), Query Frame = 0
BLAST of Sgr026049.1 vs. TAIR 10
Match: AT1G19730.1 (Thioredoxin superfamily protein ) HSP 1 Score: 150.2 bits (378), Expect = 1.0e-36 Identity = 70/119 (58.82%), Postives = 89/119 (74.79%), Query Frame = 0
BLAST of Sgr026049.1 vs. TAIR 10
Match: AT1G45145.1 (thioredoxin H-type 5 ) HSP 1 Score: 149.8 bits (377), Expect = 1.3e-36 Identity = 62/110 (56.36%), Postives = 90/110 (81.82%), Query Frame = 0
BLAST of Sgr026049.1 vs. TAIR 10
Match: AT5G42980.1 (thioredoxin 3 ) HSP 1 Score: 134.8 bits (338), Expect = 4.5e-32 Identity = 60/116 (51.72%), Postives = 86/116 (74.14%), Query Frame = 0
BLAST of Sgr026049.1 vs. TAIR 10
Match: AT5G39950.1 (thioredoxin 2 ) HSP 1 Score: 111.7 bits (278), Expect = 4.1e-25 Identity = 48/105 (45.71%), Postives = 74/105 (70.48%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|