Sgr019254.1 (mRNA) Monk fruit (Qingpiguo) v1

Overview


Name	Sgr019254.1
Type	mRNA
Organism	Siraitia grosvenorii (Monk fruit (Qingpiguo) v1)
Description	Unknown protein
Location	tig00153302: 745524 .. 745742 (+)
Sequence length	219
RNA-Seq Expression	Sgr019254.1
Synteny	Sgr019254.1

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: exonCDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGAGGGAAAACAACCAGACAAGATCCAGGAGGCAAAAAGCTAGACAAGATCTAGGAGGCAGAAAGTCAGGCAAGATTCAAATGGTGGATCAAAAGCCAAAGAAGACTAAGAAGACTCAAGAAGATTCAGAGCTAACAGAAAGCCAAAGAAGAGGAAAGAAGGCCAAAGAATATACAGAGGGTAGAAGGCCTAAGAAAATCGAAAAGGCAGAAGGCTAG

mRNA sequence

ATGAGGGAAAACAACCAGACAAGATCCAGGAGGCAAAAAGCTAGACAAGATCTAGGAGGCAGAAAGTCAGGCAAGATTCAAATGGTGGATCAAAAGCCAAAGAAGACTAAGAAGACTCAAGAAGATTCAGAGCTAACAGAAAGCCAAAGAAGAGGAAAGAAGGCCAAAGAATATACAGAGGGTAGAAGGCCTAAGAAAATCGAAAAGGCAGAAGGCTAG

Coding sequence (CDS)

ATGAGGGAAAACAACCAGACAAGATCCAGGAGGCAAAAAGCTAGACAAGATCTAGGAGGCAGAAAGTCAGGCAAGATTCAAATGGTGGATCAAAAGCCAAAGAAGACTAAGAAGACTCAAGAAGATTCAGAGCTAACAGAAAGCCAAAGAAGAGGAAAGAAGGCCAAAGAATATACAGAGGGTAGAAGGCCTAAGAAAATCGAAAAGGCAGAAGGCTAG

Protein sequence

MRENNQTRSRRQKARQDLGGRKSGKIQMVDQKPKKTKKTQEDSELTESQRRGKKAKEYTEGRRPKKIEKAEG

Homology

The following BLAST results are available for this feature:

BLAST of Sgr019254.1 vs.


Match Name	E-value	Identity	Description

BLAST of Sgr019254.1 vs.


Match Name	E-value	Identity	Description

BLAST of Sgr019254.1 vs.


Match Name	E-value	Identity	Description

BLAST of Sgr019254.1 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..72
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..20
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 27..72

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
Sgr019254	Sgr019254	gene

The following exon feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
Sgr019254.1.exon1	Sgr019254.1.exon1	exon

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
cds.Sgr019254.1	cds.Sgr019254.1	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
Sgr019254.1	Sgr019254.1-protein	polypeptide