MELO3C034592.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GAGGCAAGTTTAAGTGGCCTGAAGTGGTAGGTATGAAGGGACAACAAGCTAAAAGTAAAATTGAGAAAGATGTGTCTTTTGTGAGTGCTATATTTTTATTACCTGGAACAATTAGAATTGAAAATTTTTGTTGCAATCGTGTTTTTGTTTACCTCGATGATAAGGGCAAAGTCAATCAAATTCCGACCATTGGTTGA GAGGCAAGTTTAAGTGGCCTGAAGTGGTAGGTATGAAGGGACAACAAGCTAAAAGTAAAATTGAGAAAGATGTGTCTTTTGTGAGTGCTATATTTTTATTACCTGGAACAATTAGAATTGAAAATTTTTGTTGCAATCGTGTTTTTGTTTACCTCGATGATAAGGGCAAAGTCAATCAAATTCCGACCATTGGTTGA ATGAAGGGACAACAAGCTAAAAGTAAAATTGAGAAAGATGTGTCTTTTGTGAGTGCTATATTTTTATTACCTGGAACAATTAGAATTGAAAATTTTTGTTGCAATCGTGTTTTTGTTTACCTCGATGATAAGGGCAAAGTCAATCAAATTCCGACCATTGGTTGA MKGQQAKSKIEKDVSFVSAIFLLPGTIRIENFCCNRVFVYLDDKGKVNQIPTIG
BLAST of MELO3C034592.2 vs. NCBI nr
Match: KGN62023.1 (hypothetical protein Csa_2G287050 [Cucumis sativus]) HSP 1 Score: 60.5 bits (145), Expect = 2.1e-06 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MELO3C034592.2 vs. NCBI nr
Match: XP_018505148.1 (PREDICTED: protease inhibitor HPI-like [Pyrus x bretschneideri]) HSP 1 Score: 60.1 bits (144), Expect = 2.7e-06 Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 0
BLAST of MELO3C034592.2 vs. NCBI nr
Match: NP_190270.1 (Serine protease inhibitor, potato inhibitor I-type family protein [Arabidopsis thaliana] >CAB51179.1 putative protein [Arabidopsis thaliana] >ABE65997.1 serine protease inhibitor potato inhibitor I-type family protein [Arabidopsis thaliana] >AEE78212.1 Serine protease inhibitor, potato inhibitor I-type family protein [Arabidopsis thaliana] >OAP04666.1 hypothetical protein AXX17_AT3G40770 [Arabidopsis thaliana]) HSP 1 Score: 58.9 bits (141), Expect = 6.1e-06 Identity = 30/52 (57.69%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. NCBI nr
Match: ABK28590.1 (unknown, partial [Arabidopsis thaliana]) HSP 1 Score: 58.9 bits (141), Expect = 6.1e-06 Identity = 30/52 (57.69%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. NCBI nr
Match: XP_016684595.1 (PREDICTED: proteinase inhibitor-like [Gossypium hirsutum] >PPS09178.1 hypothetical protein GOBAR_AA11480 [Gossypium barbadense]) HSP 1 Score: 58.9 bits (141), Expect = 6.1e-06 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 58.9 bits (141), Expect = 1.1e-09 Identity = 30/52 (57.69%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 51.6 bits (122), Expect = 1.8e-07 Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TrEMBL
Match: tr|A0A0A0LJT7|A0A0A0LJT7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G287050 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-06 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TrEMBL
Match: tr|Q9STF8|Q9STF8_ARATH (Serine protease inhibitor potato inhibitor I-type family protein OS=Arabidopsis thaliana OX=3702 GN=T6H20.110 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.0e-06 Identity = 30/52 (57.69%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TrEMBL
Match: tr|A0A178VFP9|A0A178VFP9_ARATH (Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40770 PE=4 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.0e-06 Identity = 30/52 (57.69%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TrEMBL
Match: tr|A0MF11|A0MF11_ARATH (Uncharacterized protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.0e-06 Identity = 30/52 (57.69%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C034592.2 vs. TrEMBL
Match: tr|A0A1U8J2M8|A0A1U8J2M8_GOSHI (proteinase inhibitor-like OS=Gossypium hirsutum OX=3635 GN=LOC107903045 PE=4 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.0e-06 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |